DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad88C and Cad96Cb

DIOPT Version :9

Sequence 1:NP_731930.3 Gene:Cad88C / 41774 FlyBaseID:FBgn0038247 Length:1981 Species:Drosophila melanogaster
Sequence 2:NP_001287524.1 Gene:Cad96Cb / 43033 FlyBaseID:FBgn0039294 Length:789 Species:Drosophila melanogaster


Alignment Length:849 Identity:182/849 - (21%)
Similarity:309/849 - (36%) Gaps:279/849 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ILTTLISLVASNRPPRFAI---------DGQSEIVLRLKESPETKVGTLIYTLKGYDPDNDPLTF 100
            |...::||...|:....||         .|.:|..|   .:.:..||::|..|:         ..
  Fly     8 IYYAILSLCWFNKATLGAILDSRCYLEGGGSAESFL---ATEDLAVGSIIGKLR---------IN 60

  Fly   101 GKRNSHDSEI---IRIENT------GGNEAKIFLAKELDRE----LQDEYAIVLTLTDSHYSDHN 152
            |..|:...:|   :|.:|.      |..|  :.|:.|||:|    ....|..|:.:. .|.:|.:
  Fly    61 GDANAETGDINLSLREKNAPVEIHPGTKE--LALSVELDKEGVRGPSSIYVNVICIR-RHSTDPS 122

  Fly   153 YVTQSFLLLVEDINDNVPTFLPYQNAIEIPEGSAPG--VVSTLEATDADE-------------GA 202
            :|. ...:.|.|:|||.|.::.....:.:.|.:.||  ::....|.|||:             |.
  Fly   123 FVI-PVNVRVTDVNDNAPQWIGTPYTLTLSEVTVPGTRILQGARAEDADQPGPFSTVEYQVLPGP 186

  Fly   203 YGQVVYYLQELDGDNDVFSIATHQGKGILRLQKELDYERKSLYQLRVLAIDRANQGPINTGTAAI 267
            |.:.|.:|..|:              |.|.|:|.||||:...:.:::.|.|:..  |.......:
  Fly   187 YSEYVQFLNPLE--------------GTLVLKKALDYEQLQNFTVKLRAQDQGT--PPRHSDTLL 235

  Fly   268 LVKVKDLEDQPPEFVEVQAVARIAEDAPVGTKVLR---VRAIDGDRGINNPIAYSL-EAND--LF 326
            .|.:.|.:||.|:|......|.|..|...|...:|   ::|:|.|.||..||.|:: ::.|  .|
  Fly   236 RVVITDADDQNPKFQRESYSAEIPADGRPGELRMRPEPLKAVDQDEGICAPIQYTIVQSQDAKYF 300

  Fly   327 DINPHTGIVHTLTKLDREEQSDQVNGAHILRISATELSKSNTQMAPTTVRTEVTVIVSDVNDEIP 391
            .|:||.|.:..||.:.   .:|..|||.:: :.||::...: :.|.|||                
  Fly   301 RIHPHNGAISLLTPIG---YADVANGATLV-VKATQIDNPD-RYALTTV---------------- 344

  Fly   392 TFGETVYRCEVNENAQTNTPLNFIDEEVQNVVFDHDEGNNGTFRLFLDPPNDLFEIVPELAVNEA 456
                           |...|.:..|                               :..||..:.
  Fly   345 ---------------QLTRPGSHSD-------------------------------LSTLAFVQK 363

  Fly   457 NFMLRVKNSKSLDFEQFTEVNFTIFAREVDEPSRWSSAHVQIFIRDQ-NDNFPEFSQTIYNASVL 520
            .|::|::..        |.|...|.|...::|.:    |::..|.|. |..|  ||.        
  Fly   364 RFVMRIRED--------TAVGNRILALPTNKPGK----HLKYVIPDPVNSQF--FSV-------- 406

  Fly   521 ENSEQDTIITHVQAVDVDSGDYGTMGIRYTNLRGGIAHLLNLNPITGVITIKQAGGTAFDREIIS 585
                                             |.:..|:...|:              |.|.::
  Fly   407 ---------------------------------GSLGELVLAKPL--------------DYEKMT 424

  Fly   586 RHYLTVEAIDNAGQGNRNTAQIIVDILDVNDNAPTFPQRQYETKL----LENQAE-FETPL--QL 643
            :|...|.|.|  |..| :||::.::::||||..|.|.:..||..:    |:::|: ||..|  ::
  Fly   425 KHEFQVLATD--GMTN-STAELTLEVIDVNDWEPRFRETHYEFMVPKSSLQSRADSFEGVLIGKV 486

  Fly   644 EARDADLNGTENSQVTYEIVEGLYRSNFTIDPQSGL-LRPVHSFDFEELVDGSSRRSDPYTGGSF 707
            ||.|.|.|  :..:::   :.|.:...|.||....: :||      |:|             .|.
  Fly   487 EAADGDRN--DKLELS---LRGQHAGLFEIDSTGNIYMRP------EQL-------------QSL 527

  Fly   708 SIREIDLLVRARDSGIPMLSTVVPVLIYVQDV-------NDN--------------------API 745
            :...:.|:..|.|:|:|..||.|||.:.::.:       |.|                    ..|
  Fly   528 NESTVHLIAIATDTGVPPRSTSVPVSVTMEGLTLARSGWNSNMLGMFGMIMGLFLMIIVALSCYI 592

  Fly   746 FQQSFYAKTVPEDLPGGSSVLQVTAIDRDGSAPNNVVVYRIQTGAGD---KFIINSETGVISVAH 807
            .:.....|:....|..|.:.:...|.....||  |:|.:....|.|:   ..:.:....|:.:.|
  Fly   593 VRSKKQGKSASSGLGLGRNRVHSQAHSSVSSA--NLVTHEKLAGNGNGNGASVTSGGVSVLHMKH 655

  Fly   808 GANL 811
            |.|:
  Fly   656 GGNI 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad88CNP_731930.3 Cadherin_repeat 76..168 CDD:206637 24/104 (23%)
Cadherin_repeat 179..276 CDD:206637 25/111 (23%)
Cadherin_repeat 287..388 CDD:206637 31/106 (29%)
Cadherin_repeat 397..506 CDD:206637 16/109 (15%)
Cadherin_repeat 514..617 CDD:206637 16/102 (16%)
Cadherin_repeat 625..742 CDD:206637 32/131 (24%)
Cadherin_repeat 751..853 CDD:206637 14/64 (22%)
Cadherin_repeat 865..976 CDD:206637
Cadherin_repeat 985..1080 CDD:206637
Cadherin_repeat 1090..1191 CDD:206637
CA 1221..1302 CDD:214520
Cadherin_repeat 1312..1409 CDD:206637
Cadherin_repeat 1418..>1502 CDD:206637
Cadherin_repeat 1617..1710 CDD:206637
Cad96CbNP_001287524.1 Cadherin_repeat 46..137 CDD:206637 24/103 (23%)
Cadherin_repeat 145..244 CDD:206637 25/114 (22%)
Cadherin_repeat 253..347 CDD:206637 32/129 (25%)
Cadherin_repeat 365..452 CDD:206637 29/158 (18%)
Cadherin_repeat 461..555 CDD:206637 31/117 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24028
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.