DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad88C and PCDHB5

DIOPT Version :9

Sequence 1:NP_731930.3 Gene:Cad88C / 41774 FlyBaseID:FBgn0038247 Length:1981 Species:Drosophila melanogaster
Sequence 2:NP_056484.2 Gene:PCDHB5 / 26167 HGNCID:8690 Length:795 Species:Homo sapiens


Alignment Length:736 Identity:211/736 - (28%)
Similarity:316/736 - (42%) Gaps:139/736 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   506 NFPEFSQTIYNASVLENSEQDTIITHVQAVDVDSGDYGTMGIR--YTNLRGGIAHLLNLNPITGV 568
            :.||.:::.|:.:   |..:|        :.:..|:..|.|.|  |.    |...||.|:..||.
Human    34 SIPEETESGYSVA---NLAKD--------LGLGVGELATRGARMHYK----GNKELLQLDIKTGN 83

  Fly   569 ITIKQAGGTAFDREIIS-------RHYLTVEAIDNAGQGNRNTAQIIVDILDVNDNAPTFPQRQY 626
            :.:.:    ..|||::.       .|:..:  ::|..|    ..|..:.:.|:||:||.||:::.
Human    84 LLLYE----KLDREVMCGATEPCILHFQLL--LEN
PVQ----FFQTDLQLTDINDHAPEFPEKEM 138

  Fly   627 ETKLLEN-QAEFETPLQLEARDADLNGTENSQVTYEIVEGLYRSNFTIDPQSGLLRPVHS----F 686
            ..|:.|: |.....||:: |:|.|: |:...|            |:||.|.|......|:    .
Human   139 LLKIPESTQPGTVFPLKI-AQDFDI-GSNTVQ------------NYTISPNSHFHVATHNRGDGR 189

  Fly   687 DFEELV--DGSSRRSDPYTGGSFSIREIDLLVRARDSGIPMLSTVVPVLIYVQDVNDNAPIFQQS 749
            .:.|||  ....|...|         |:.|.:.|.|.|.|..|....:.|.|.|.|||||.|.||
Human   190 KYPELVLDKALDREERP---------ELSLTLTALDGGAPPRSGTTTIRIVVLDNNDNAPEFLQS 245

  Fly   750 FYAKTVPEDLPGGSSVLQVTAIDRDGSAPNNVVVYRIQTGAGDK----FIINSETGVISVAHGAN 810
            ||...|||:.|..|.|:.|:|.|.|..|..:|.....|   ||:    |:|:.:|..|.:...  
Human   246 FYEVQVPENSPLNSLVVVVSARDLDAGAYGSVAYALFQ---GDEVTQPFVIDEKTAEIRLKRA-- 305

  Fly   811 LDPDLTESKRSLYTLSVIALDGGLGNSQLMTTCTVNISIQDVNNKPPVLKEMPALQ--ILENTPV 873
            ||.:.|    ..|.:.::|.|||    .|...|||.|.:.|||:..|.| .|..|.  ..||.| 
Human   306 LDFEAT----PYYNVEIVATDGG----GLSGKCTVAIEVVDVNDNAPEL-TMSTLSSPTPENAP- 360

  Fly   874 GTLVYRIQATDLDHKAILRYKLNPEHCEGRTEEGALVKSSEYD--FLGAFEVDSIEGTLK----- 931
            .|:|.....:|.|                ..:.|.::.|.:.|  ||       ::.|||     
Human   361 ETVVAVFSVSDPD----------------SGDNGRMICSIQNDLPFL-------LKPTLKNFYTL 402

  Fly   932 -VVKLLDRERVEHIKLAITVEDLAAAKGRQIAEGFLSIQVLDENDNNPKFRLPFYRQSITENSIN 995
             ..:.||||......:.|||.|:...  |...|..:::.|.|.|||.|.|....|...:.||:..
Human   403 VTQRTLDRESQAEYNITITVTDMGTP--RLKTEHNITVLVSDVNDNAPAFTQTSYTLFVRENNSP 465

  Fly   996 GAMIVNVLASDVDK--NRTITYAL--EGNPTYR--SLMHLDPQTGEIVVASKIDHEQHQWLNFSV 1054
            ...|.:|.|:|.|.  |..:||:|  ..||..|  ||:.::...|.:.....:|:|..|...|.|
Human   466 ALHIGSVSATDRDSGTNAQVTYSLLPPQNPHLRLASLVSINADNGHLFALRSLDYEALQAFEFRV 530

  Fly  1055 RATDSGIPARSSLVDVYITVLDENDNNPYFV----GGSKNYT--ISENAAPGTRVATLQAGDADS 1113
            .|||.|.||.||...|.:.|||.|||:|:.:    .||...|  :...|.||..|..:.|.|.||
Human   531 GATDRGSPALSSEALVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDS 595

  Fly  1114 GDFGKITFLMDRISSQGKFTIDADTGVLTVADRLDRESKDSYNLVIEAWDNYQFGFLAGE-SRNA 1177
            |....:::.:.:.:..|.|::.|..|.:..|..|.......:.||:...||       || .|:|
Human   596 GQNAWLSYQLLKATEPGLFSMWAHNGEVRTARLLSERDAAKHRLVVLVKDN-------GEPPRSA 653

  Fly  1178 FKQVFISILDENDNPPEVDLP 1198
            ...:.:.::| ..:.|.:.||
Human   654 TATLHVLLVD-GFSQPYLPLP 673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad88CNP_731930.3 Cadherin_repeat 76..168 CDD:206637
Cadherin_repeat 179..276 CDD:206637
Cadherin_repeat 287..388 CDD:206637
Cadherin_repeat 397..506 CDD:206637 211/736 (29%)
Cadherin_repeat 514..617 CDD:206637 23/111 (21%)
Cadherin_repeat 625..742 CDD:206637 32/123 (26%)
Cadherin_repeat 751..853 CDD:206637 34/105 (32%)
Cadherin_repeat 865..976 CDD:206637 29/120 (24%)
Cadherin_repeat 985..1080 CDD:206637 36/100 (36%)
Cadherin_repeat 1090..1191 CDD:206637 25/103 (24%)
CA 1221..1302 CDD:214520
Cadherin_repeat 1312..1409 CDD:206637
Cadherin_repeat 1418..>1502 CDD:206637
Cadherin_repeat 1617..1710 CDD:206637
PCDHB5NP_056484.2 Cadherin_2 30..112 CDD:311943 20/98 (20%)
Cadherin_repeat 140..238 CDD:206637 32/120 (27%)
Cadherin_repeat 247..342 CDD:206637 36/107 (34%)
Cadherin_repeat 356..446 CDD:206637 28/115 (24%)
Cadherin_repeat 454..556 CDD:206637 36/101 (36%)
Cadherin_repeat 575..663 CDD:206637 23/94 (24%)
Cadherin_C_2 684..767 CDD:318652
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7815
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.