DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His4r and HHF1

DIOPT Version :9

Sequence 1:NP_001262576.1 Gene:His4r / 41773 FlyBaseID:FBgn0013981 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_009563.1 Gene:HHF1 / 852294 SGDID:S000000213 Length:103 Species:Saccharomyces cerevisiae


Alignment Length:103 Identity:94/103 - (91%)
Similarity:100/103 - (97%) Gaps:0/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN 65
            |:|||||||||||||||||||:||||||||||||||||||||||||||||||||.|.|||.|||:
Yeast     1 MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLES 65

  Fly    66 VIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103
            ||||:|||||||||||||::||||||||||||||||||
Yeast    66 VIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His4rNP_001262576.1 PLN00035 1..103 CDD:177669 92/101 (91%)
HHF1NP_009563.1 PTZ00015 18..101 CDD:185397 74/82 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345225
Domainoid 1 1.000 110 1.000 Domainoid score I1394
eggNOG 1 0.900 - - E2759_KOG3467
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 193 1.000 Inparanoid score I894
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53718
OrthoFinder 1 1.000 - - FOG0002946
OrthoInspector 1 1.000 - - oto99996
orthoMCL 1 0.900 - - OOG6_100120
Panther 1 1.100 - - LDO PTHR10484
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R544
SonicParanoid 1 1.000 - - X2948
TreeFam 00.000 Not matched by this tool.
1312.830

Return to query results.
Submit another query.