DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His4r and H4C7

DIOPT Version :9

Sequence 1:NP_001262576.1 Gene:His4r / 41773 FlyBaseID:FBgn0013981 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_003538.1 Gene:H4C7 / 8369 HGNCID:4792 Length:98 Species:Homo sapiens


Alignment Length:98 Identity:82/98 - (83%)
Similarity:83/98 - (84%) Gaps:0/98 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN 65
            |:.|||.||||||||||.|||||.||||||||..||||||.||||||.||||||||.|.||||||
Human     1 MSVRGKAGKGLGKGGAKCHRKVLSDNIQGITKCTIRRLARHGGVKRILGLIYEETRRVFKVFLEN 65

  Fly    66 VIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTL 98
            ||..|||.||||||||||||.|||.||||||||
Human    66 VIWYAVTNTEHAKRKTVTAMAVVYVLKRQGRTL 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His4rNP_001262576.1 PLN00035 1..103 CDD:177669 82/98 (84%)
H4C7NP_003538.1 PTZ00015 19..98 CDD:185397 66/78 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155238
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG3467
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53718
OrthoDB 1 1.010 - - D1594208at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.