DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His4r and H4C4

DIOPT Version :10

Sequence 1:NP_524352.1 Gene:His4r / 41773 FlyBaseID:FBgn0013981 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_003530.1 Gene:H4C4 / 8360 HGNCID:4782 Length:103 Species:Homo sapiens


Alignment Length:70 Identity:14/70 - (20%)
Similarity:23/70 - (32%) Gaps:23/70 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   446 PKSSYRKFFADYTNGHRRLGRDDSHEFNDY----------------DNFLFYAE-----DSDSET 489
            |..:|  ||:..|..|.......|...:|:                .|:.::.|     .|.|.:
Human    54 PPQAY--FFSSLTQTHSPGPHFSSDSNSDFVPPHSSSHPRSSSCFGQNYTYFGEKLPSPHSISPS 116

  Fly   490 DYPEC 494
            :|..|
Human   117 NYQLC 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His4rNP_524352.1 PLN00035 1..103 CDD:177669
H4C4NP_003530.1 PLN00035 1..103 CDD:177669 9/50 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.