DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His4r and AT3G46320

DIOPT Version :10

Sequence 1:NP_524352.1 Gene:His4r / 41773 FlyBaseID:FBgn0013981 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_850660.1 Gene:AT3G46320 / 823777 AraportID:AT3G46320 Length:103 Species:Arabidopsis thaliana


Alignment Length:53 Identity:15/53 - (28%)
Similarity:24/53 - (45%) Gaps:10/53 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   447 KSSYRKFFADYTNGHRRLGRDDSHEFNDYDNFLFYAEDSDSETDYPECEDVIR 499
            ||:..|||    ||      |......|.....:||:|..:.|.||:..::::
plant  1166 KSTTVKFF----NG------DVKQVLGDQRIIYYYADDQTTHTTYPDGLEILQ 1208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His4rNP_524352.1 PLN00035 1..103 CDD:177669
AT3G46320NP_850660.1 PLN00035 1..103 CDD:177669
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.