DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His4r and h4c1

DIOPT Version :9

Sequence 1:NP_001262576.1 Gene:His4r / 41773 FlyBaseID:FBgn0013981 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001016869.1 Gene:h4c1 / 549623 XenbaseID:XB-GENE-5724689 Length:103 Species:Xenopus tropicalis


Alignment Length:103 Identity:102/103 - (99%)
Similarity:103/103 - (100%) Gaps:0/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN 65
            |:|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog     1 MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN 65

  Fly    66 VIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103
            ||||||||||||||||||||||||||||||||||||||
 Frog    66 VIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His4rNP_001262576.1 PLN00035 1..103 CDD:177669 100/101 (99%)
h4c1NP_001016869.1 PLN00035 1..103 CDD:177669 100/101 (99%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 17/18 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I5616
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 204 1.000 Inparanoid score I3634
OMA 1 1.010 - - QHG53718
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002946
OrthoInspector 1 1.000 - - oto104650
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R544
SonicParanoid 1 1.000 - - X2948
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.