DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His4r and His4:CG33895

DIOPT Version :9

Sequence 1:NP_001262576.1 Gene:His4r / 41773 FlyBaseID:FBgn0013981 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001027317.1 Gene:His4:CG33895 / 3772325 FlyBaseID:FBgn0053895 Length:103 Species:Drosophila melanogaster


Alignment Length:103 Identity:103/103 - (100%)
Similarity:103/103 - (100%) Gaps:0/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLEN 65

  Fly    66 VIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103
            ||||||||||||||||||||||||||||||||||||||
  Fly    66 VIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His4rNP_001262576.1 PLN00035 1..103 CDD:177669 101/101 (100%)
His4:CG33895NP_001027317.1 PLN00035 1..103 CDD:177669 101/101 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461575
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG3467
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100120
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.730

Return to query results.
Submit another query.