DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment put and CRK42

DIOPT Version :9

Sequence 1:NP_001262575.1 Gene:put / 41772 FlyBaseID:FBgn0003169 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_198854.3 Gene:CRK42 / 834036 AraportID:AT5G40380 Length:651 Species:Arabidopsis thaliana


Alignment Length:563 Identity:139/563 - (24%)
Similarity:211/563 - (37%) Gaps:189/563 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 HGIIECEHFDEKMCNTTQQC----ETRIEHCKMEADKFPSCYVLWSVNETTGILRIKMKGCF--- 88
            :.:|:|.  |:...:..|.|    .|||..|      .||           ...||.:.|||   
plant    85 YALIQCH--DDLSPSDCQLCYAIARTRIPRC------LPS-----------SSARIFLDGCFLRY 130

  Fly    89 -------------TDMHECNQTECVTSAEPRQG-----------------------NIH------ 111
                         :|...|:..   |..:||.|                       .:|      
plant   131 ETYEFYDESVSDASDSFSCSND---TVLDPRFGFQVSETAARVAVRKGGFGVAGENGVHALAQCW 192

  Fly   112 ---------FCCCKG----SRCNSNQKYIKSTTEATTQVPKEKTQDGSN------------LIYI 151
                     .|..|.    .||.|.::.....|....:....|..:|..            ::.|
plant   193 ESLGKEDCRVCLEKAVKEVKRCVSRREGRAMNTGCYLRYSDHKFYNGDGHHKFHVLFNKGVIVAI 257

  Fly   152 YIGTSVFSVLMVIVGMGLLLYR--RRKQ---------AHFNEIPT---HEAEITNSSPLLSNRPI 202
            .:.||.| |:::::...:::.:  :.||         ..||...|   :|. :..::...|::  
plant   258 VLTTSAF-VMLILLATYVIMTKVSKTKQEKRNLGLVSRKFNNSKTKFKYET-LEKATDYFSHK-- 318

  Fly   203 QLLEQKASGRFGDVWQAKL-NNQDVAVK--IFRMQEKESWTTE--HDIYKLPRMRHPNILEFLGV 262
            ::|.|   |..|.|:...| |.::||||  :|..::   |..|  :::..:..::|.|:::.||.
plant   319 KMLGQ---GGNGTVFLGILPNGKNVAVKRLVFNTRD---WVEEFFNEVNLISGIQHKNLVKLLGC 377

  Fly   263 EKHMDKPEYWLISTYQHNGSLCDYL----KSHTISWPELCRIAESMANGLAHLHEEIPASKTDGL 323
            .  ::.||..|:..|..|.||..:|    :|..::|.:...|....|.|||:||...|.      
plant   378 S--IEGPESLLVYEYVPNKSLDQFLFDESQSKVLNWSQRLNIILGTAEGLAYLHGGSPV------ 434

  Fly   324 KPSIAHRDFKSKNVLLKSDLTACIADFGLAMIFQPGKPCGDTH---GQVGTRRYMAPE-VLEGAI 384
              .|.|||.|:.||||...|...|||||||..|...|    ||   |..||..||||| |:.|.:
plant   435 --RIIHRDIKTSNVLLDDQLNPKIADFGLARCFGLDK----THLSTGIAGTLGYMAPEYVVRGQL 493

  Fly   385 NFNRDAFLRIDVYACGLVLWEMVSRCDFAGPVGEFQLPFEAELG------------------LRP 431
            .      .:.|||:.|:::.|:.  |      |.....|..|.|                  |.|
plant   494 T------EKADVYSFGVLVLEIA--C------GTRINAFVPETGHLLQRVWNLYTLNRLVEALDP 544

  Fly   432 SL-DE---VQ--ESVVMKKLRPRLLNSWRAHPGLNVFCDTMEE 468
            .| ||   ||  |:...|.||..||.: :|.|.|.   .:|||
plant   545 CLKDEFLQVQGSEAEACKVLRVGLLCT-QASPSLR---PSMEE 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
putNP_001262575.1 Activin_recp 38..126 CDD:279413 26/149 (17%)
STKc_ACVR2 206..493 CDD:270955 95/300 (32%)
S_TKc 210..479 CDD:214567 94/296 (32%)
CRK42NP_198854.3 Stress-antifung 40..131 CDD:279926 16/64 (25%)
Stress-antifung <174..232 CDD:279926 7/57 (12%)
Pkinase_Tyr 319..588 CDD:285015 96/303 (32%)
STKc_IRAK 321..590 CDD:270968 96/301 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.