DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment put and Amhr2

DIOPT Version :10

Sequence 1:NP_001262575.1 Gene:put / 41772 FlyBaseID:FBgn0003169 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_653130.2 Gene:Amhr2 / 110542 MGIID:105062 Length:568 Species:Mus musculus


Alignment Length:47 Identity:12/47 - (25%)
Similarity:20/47 - (42%) Gaps:6/47 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 PPQEILSKDSVTVSVDAVIYFRISNATVSVINVEDAARSTKLLAQTT 146
            |...::|.|  |.||.:::....|.|:.:    .|...:|..|...|
Mouse   234 PTDLLISHD--TASVSSILLMTTSEASTT----SDTTTTTPKLKDFT 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
putNP_001262575.1 TFP_LU_ECD_ACVR2 33..125 CDD:467135 7/24 (29%)
STKc_ACVR2 206..493 CDD:270955
Amhr2NP_653130.2 TFP_LU_ECD_AMHR2 22..121 CDD:467136
Protein Kinases, catalytic domain 203..504 CDD:473864 12/47 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.