DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14853 and erich2

DIOPT Version :9

Sequence 1:NP_001262573.1 Gene:CG14853 / 41771 FlyBaseID:FBgn0038246 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_009300381.1 Gene:erich2 / 561824 ZFINID:ZDB-GENE-131231-2 Length:310 Species:Danio rerio


Alignment Length:227 Identity:66/227 - (29%)
Similarity:103/227 - (45%) Gaps:52/227 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AVRPNSSNGHMDNDNGLNGSGAPATTSTTTG------------TATAAGAALMATANNINIMNGA 69
            :::.:|||    :..|.|.|.||:..:.||.            ||..........:.:::.::..
Zfish   117 SLKAHSSN----SSRGYNASKAPSFRNVTTHGHKPPKQVPSIMTALEKQEECEVQSESVHELHTQ 177

  Fly    70 AAAAAASASGLPTSASSEDLSQSLSEYTDADESVSAPTEFLAEFLSAVMLKDYKKALKYCKLILQ 134
            |.....||:...:..:..|     .|..::||.: .|.|..||||.|||:|:|:.|.|.|::||.
Zfish   178 APGEVLSANDKESPEAQHD-----EEENESDEGL-VPLELFAEFLQAVMIKNYQLAKKLCQMILI 236

  Fly   135 YEPDNATAKEFYPLILDKLRAVATSSDSDENYNKSSSPDLALDLHASDVEADVDGDEAGDADEDG 199
            |||.|:.||.|.|||.:||                        |..:|.|:|.|.||:..:|::.
Zfish   237 YEPQNSEAKWFLPLIEEKL------------------------LMEADEESDDDDDESDTSDDND 277

  Fly   200 DADADGDGSESSNNCSEEEDNGWGDDEIDNVD 231
            |.|.|.|..|||.:...:|::      ||:.|
Zfish   278 DEDDDDDDDESSESSDTDEES------IDSTD 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14853NP_001262573.1 Fis1 <119..154 CDD:304536 18/34 (53%)
erich2XP_009300381.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587943
Domainoid 1 1.000 81 1.000 Domainoid score I8415
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5182
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008318
OrthoInspector 1 1.000 - - oto39856
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21520
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.080

Return to query results.
Submit another query.