DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14853 and Erich2

DIOPT Version :9

Sequence 1:NP_001262573.1 Gene:CG14853 / 41771 FlyBaseID:FBgn0038246 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_006234402.1 Gene:Erich2 / 499806 RGDID:1563852 Length:440 Species:Rattus norvegicus


Alignment Length:146 Identity:47/146 - (32%)
Similarity:70/146 - (47%) Gaps:40/146 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 EDLSQSLSEYTDAD---------------ESVSAPTEFLAEFLSAVMLKDYKKALKYCKLILQYE 136
            ||:.::||:.||.|               :...||.|.:||||.|.|.:||:.|.|.|::||.||
  Rat   317 EDIEENLSDSTDGDGEEDSNNEDDEGPAKKETRAPLELMAEFLRAEMGRDYQLAKKLCQMILIYE 381

  Fly   137 PDNATAKEFYPLILDKLRAVATSSDSDENYNKSSSPDLALDLHASDVEADVDGDEAGDADEDGDA 201
            |:|..||||:.||                      .::.|...|.:.|.:.:.||  |:..:.:.
  Rat   382 PENPVAKEFFSLI----------------------EEILLKEKAQEEEEEEESDE--DSSSESEV 422

  Fly   202 DADGDGSE-SSNNCSE 216
            |:..|||| ||:.|.:
  Rat   423 DSSEDGSEDSSDECED 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14853NP_001262573.1 Fis1 <119..154 CDD:304536 17/34 (50%)
Erich2XP_006234402.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346556
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008318
OrthoInspector 1 1.000 - - oto96449
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21520
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.