DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7987 and CG4496

DIOPT Version :9

Sequence 1:NP_650375.1 Gene:CG7987 / 41768 FlyBaseID:FBgn0038244 Length:1283 Species:Drosophila melanogaster
Sequence 2:NP_001285707.1 Gene:CG4496 / 34000 FlyBaseID:FBgn0031894 Length:580 Species:Drosophila melanogaster


Alignment Length:663 Identity:133/663 - (20%)
Similarity:217/663 - (32%) Gaps:209/663 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 DRPHLCKLCGARFSRRAELISHFKAHAEAQDAADAEAAAAAADSSSAIKFEHQTQRQ----LDDH 225
            ::|..|..|    .:...|:....|.|....:.||.......|   .:::|:|...:    :||.
  Fly     6 NKPSSCVDC----CKDCTLLPCCSASACCDASCDAACGLIPPD---PVRYEYQEPEENFISIDDV 63

  Fly   226 YYEQ-EWPLFQHQQEQENAQQNVHQQHQIVEEGGIQLVASYPDTVAQPAAPSRGRISRLKPKEES 289
            ..:. .|.:.|.|:|:|...:.:.:|.:                          |..|.|.:.|:
  Fly    64 KIKSFLWQIGQQQREKELEIKRIMEQEK--------------------------REKREKERREA 102

  Fly   290 SQFIVISDKSVEDSRPYMEPEPAQPVVTTSEFIAVEPPPQPNFPVLDHSKPFVCQQCGLAFAREK 354
                              |....|.|:...|..|..|.                   ||..:..:
  Fly   103 ------------------EKRRDQEVIELDEEEAQSPR-------------------GLIISAAR 130

  Fly   355 ALVSHTKNHRVDSPFECNQCQEMFWDNSSLQE------------HQKTHQFEESNSEYDPASAEE 407
            :| :|                   | |||::.            |:...:.|.|:|::|      
  Fly   131 SL-AH-------------------W-NSSIRRVTPDIELIPRRVHRVVAEIELSDSDHD------ 168

  Fly   408 SGSESEADEQLYGEFYCNECGISFHRQDLLRRHAKM-HCKPSDQAAVGSNSDV---TAGGDVELA 468
              .:||.||.:........|.::..|||..:...:: ...||||.......:|   .:.|...|.
  Fly   169 --EDSEVDEDVSLPSNAVSCVLNEQRQDGSQNPQELVIIVPSDQEDEQKTDNVIKRKSSGSRRLV 231

  Fly   469 KDSSG--------HCCNTCGKSFPSALEMLAHAEIHARFPPFKCVLCGISFYEEQAIKRH--LHT 523
            |...|        :.|..|||...|...:..|..||....||.|.||...|.|...:|:|  .|:
  Fly   232 KRRPGANRRGRHMYECPDCGKKVQSNYNLRRHMMIHTGERPFPCDLCERRFREFSDLKKHRRRHS 296

  Fly   524 RHPSELNANSCVLCG------------KECRDRKALIKHAWDHSREKC---HSCSKCGKNFH-NK 572
            ..|..:    |::|.            .:|..:..::|...:...||.   ||....|.:.. .:
  Fly   297 HDPQFI----CMICHLGAPLEQDSTRCADCESKNLMVKPQPEELGEKTTEEHSDEMEGDDDEIEE 357

  Fly   573 ARLKRH-------------------------MASHRDKSVVCEVCQEEFPDGRTLSNHRHSHSTT 612
            |.|:..                         :.||...|        ..|..|:.|:...|.|.:
  Fly   358 AALENEKQPQVATQPSLMVTLIPPIQSPPEKVPSHTQPS--------RPPLPRSCSSANSSSSLS 414

  Fly   613 TPGKL-----------FPCLECGKTFGSRSSQQIHVRIHTGERPYGCRYCWKAFADGGTLRKHER 666
            ..|.:           :||..|.:.||:|.:.:.|..|||||:|:.|..|.|.|.:..||:||..
  Fly   415 NDGNIAGKSMSRTRRSYPCPLCHRPFGTRHNLKRHYMIHTGEKPFSCSKCRKPFRECSTLKKHMV 479

  Fly   667 IHTGEKPYACSVCPRAFNQRVVLREHIRSHHSGLDVARNTYH---------------CTVCSEDL 716
            .|..::.|.|..||..|...:...:|..:|...|...:::.:               |..|.:..
  Fly   480 THVRDRWYKCLRCPSKFRDYLEYSDHKNNHQDQLSSRKSSIYESDDDGDSSVEDCLECCECQQRF 544

  Fly   717 ASSNDLIQHLIQH 729
            ...:....||.:|
  Fly   545 TELDAYTAHLKKH 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7987NP_650375.1 C2H2 Zn finger 142..162 CDD:275368
C2H2 Zn finger 170..186 CDD:275368 3/15 (20%)
COG5048 326..734 CDD:227381 105/497 (21%)
C2H2 Zn finger 343..363 CDD:275368 4/19 (21%)
C2H2 Zn finger 371..391 CDD:275368 5/31 (16%)
C2H2 Zn finger 424..444 CDD:275368 4/20 (20%)
C2H2 Zn finger 476..496 CDD:275368 6/19 (32%)
C2H2 Zn finger 504..523 CDD:275368 7/20 (35%)
C2H2 Zn finger 534..554 CDD:275370 4/31 (13%)
C2H2 Zn finger 562..582 CDD:275370 3/45 (7%)
C2H2 Zn finger 589..609 CDD:275368 3/19 (16%)
C2H2 Zn finger 620..640 CDD:275368 6/19 (32%)
C2H2 Zn finger 648..668 CDD:275368 8/19 (42%)
zf-H2C2_2 661..685 CDD:290200 9/23 (39%)
C2H2 Zn finger 676..696 CDD:275368 5/19 (26%)
C2H2 Zn finger 709..726 CDD:275371 2/16 (13%)
Hph 921..>1017 CDD:290417
CG4496NP_001285707.1 zf-C2H2 245..267 CDD:278523 6/21 (29%)
C2H2 Zn finger 247..267 CDD:275368 6/19 (32%)
zf-H2C2_2 259..282 CDD:290200 8/22 (36%)
C2H2 Zn finger 275..295 CDD:275368 7/19 (37%)
zf-C2H2 431..453 CDD:278523 7/21 (33%)
C2H2 Zn finger 433..453 CDD:275368 6/19 (32%)
zf-H2C2_2 445..468 CDD:290200 10/22 (45%)
C2H2 Zn finger 461..481 CDD:275368 8/19 (42%)
C2H2 Zn finger 489..510 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.