DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cys and CYSB

DIOPT Version :9

Sequence 1:NP_476856.1 Gene:Cys / 41767 FlyBaseID:FBgn0004629 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_850570.2 Gene:CYSB / 820428 AraportID:AT3G12490 Length:234 Species:Arabidopsis thaliana


Alignment Length:104 Identity:30/104 - (28%)
Similarity:46/104 - (44%) Gaps:13/104 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LGLVLVSLIATQAA----DEQVVGGVSQLEGNSRKEALELLDATLAQLATG-----DGPSYKAIN 65
            |.|.:.||||:...    :..:||||..:..|.....:|    :||:.|..     :....:...
plant    15 LSLFISSLIASDLGFCNEEMALVGGVGDVPANQNSGEVE----SLARFAVDEHNKKENALLEFAR 75

  Fly    66 VTSVTGQVVAGSLNTYEVELDNGSDKKQCTVKIWTQPWL 104
            |.....|||||:|:...:|:.....||....|:|.:|||
plant    76 VVKAKEQVVAGTLHHLTLEILEAGQKKLYEAKVWVKPWL 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CysNP_476856.1 CY 26..115 CDD:214484 24/84 (29%)
CYSBNP_850570.2 CY 35..124 CDD:214484 24/84 (29%)
CY 146..>207 CDD:415608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565344at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.