DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cys and CYSA

DIOPT Version :9

Sequence 1:NP_476856.1 Gene:Cys / 41767 FlyBaseID:FBgn0004629 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_181620.1 Gene:CYSA / 818685 AraportID:AT2G40880 Length:125 Species:Arabidopsis thaliana


Alignment Length:111 Identity:25/111 - (22%)
Similarity:49/111 - (44%) Gaps:16/111 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VKSLCILGLVLVSLIATQAADEQ---VVGGVSQLEGNSRKEALELLDATLAQLATGDGP------ 59
            :.:|.:.|.:.:::..::....:   ::|||..|.||.....:|    :||:.|..:..      
plant     8 IVTLLLCGTIQLAICRSEEKSTEKTMMLGGVHDLRGNQNSGEIE----SLARFAIQEHNKQQNKI 68

  Fly    60 -SYKAINVTSVTGQVVAGSLNTYEVELDNGSDKKQCTVKIWTQPWL 104
             .:|  .:.....|||||::....:|...|...|....|:|.:||:
plant    69 LEFK--KIVKAREQVVAGTMYHLTLEAKEGDQTKNFEAKVWVKPWM 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CysNP_476856.1 CY 26..115 CDD:214484 23/89 (26%)
CYSANP_181620.1 CY 33..121 CDD:214484 23/86 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CZYG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565344at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.