DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cys and Cst11

DIOPT Version :9

Sequence 1:NP_476856.1 Gene:Cys / 41767 FlyBaseID:FBgn0004629 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_084335.1 Gene:Cst11 / 78240 MGIID:1925490 Length:139 Species:Mus musculus


Alignment Length:131 Identity:34/131 - (25%)
Similarity:54/131 - (41%) Gaps:34/131 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVLVSLIATQAADEQV-------VGGVSQLEGNSRKEALELLDATLAQLATGDGPSYKAINVTSV 69
            |:|..|:|..|...||       :..||.|| :|.||.||.:.....: .:.|..:::.:.:..:
Mouse    11 LLLAILVALVAFSYQVKRKTFIRIEEVSALE-SSVKETLEYVTDEYNK-KSEDLYNFRILRILKI 73

  Fly    70 TGQVVAGSLN---TYEV-------------ELDNGS--DKKQCTVKIWTQPW------LKENGTN 110
            ..| |.|.|.   |.|:             ::..|.  .|.||...::..||      ||:|.|:
Mouse    74 MKQ-VTGHLEYHITVEMQRTTCLKTETSLCDIQKGELHKKIQCYFSVYAIPWVEVFKILKKNCTD 137

  Fly   111 I 111
            |
Mouse   138 I 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CysNP_476856.1 CY 26..115 CDD:214484 29/117 (25%)
Cst11NP_084335.1 CY 34..136 CDD:214484 25/104 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565344at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.