powered by:
Protein Alignment Cys and Cst6
DIOPT Version :9
Sequence 1: | NP_476856.1 |
Gene: | Cys / 41767 |
FlyBaseID: | FBgn0004629 |
Length: | 126 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_082899.1 |
Gene: | Cst6 / 73720 |
MGIID: | 1920970 |
Length: | 149 |
Species: | Mus musculus |
Alignment Length: | 45 |
Identity: | 11/45 - (24%) |
Similarity: | 21/45 - (46%) |
Gaps: | 4/45 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 TSVTGQVVAGSLNTYEVELDNGSDKKQCTVKIWTQPWLKENGTNI 111
|.|:|:.: .|.|..:......:|.:|..::...|| :|.|.:
Mouse 101 TRVSGEHM--DLTTCPLAAGGQQEKLRCNFELLEVPW--KNTTQL 141
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Cys | NP_476856.1 |
CY |
26..115 |
CDD:214484 |
11/45 (24%) |
Cst6 | NP_082899.1 |
CY |
<59..147 |
CDD:214484 |
11/45 (24%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2CZYG |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1565344at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.