DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cys and LOC689220

DIOPT Version :9

Sequence 1:NP_476856.1 Gene:Cys / 41767 FlyBaseID:FBgn0004629 Length:126 Species:Drosophila melanogaster
Sequence 2:XP_003749635.1 Gene:LOC689220 / 689220 RGDID:1594832 Length:141 Species:Rattus norvegicus


Alignment Length:119 Identity:26/119 - (21%)
Similarity:50/119 - (42%) Gaps:29/119 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VLVSLIATQAADEQVVGGV--SQLEGNSRKEALELLDATLAQLATGDGPSY--KAINVTSVTGQV 73
            :||..:.|......::||:  |.:|....:|:|..   .::|....:...|  :.:.|.:|..||
  Rat    16 MLVLKLCTYPVLGHILGGIEKSSMEDEGARESLNF---AVSQYNENNSDLYLSRVLEVKNVQKQV 77

  Fly    74 VAGSLNTYEVEL--------------------DNGSDKKQCTVKIWTQPWLKEN 107
            |||:...::|.|                    |...:::.|:.:::..||  ||
  Rat    78 VAGTKFLFDVILVKTNCLKSQNDLTNCPAKDQDGQQEQEFCSFEVYDAPW--EN 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CysNP_476856.1 CY 26..115 CDD:214484 23/106 (22%)
LOC689220XP_003749635.1 CY 30..139 CDD:214484 23/105 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CZYG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565344at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.