powered by:
Protein Alignment Cys and Cst13
DIOPT Version :9
Sequence 1: | NP_476856.1 |
Gene: | Cys / 41767 |
FlyBaseID: | FBgn0004629 |
Length: | 126 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001102813.1 |
Gene: | Cst13 / 502679 |
RGDID: | 1564873 |
Length: | 141 |
Species: | Rattus norvegicus |
Alignment Length: | 71 |
Identity: | 13/71 - (18%) |
Similarity: | 27/71 - (38%) |
Gaps: | 22/71 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 54 ATGDGPSYKAINVTSVTGQVVAGSLNTY-EVELDN------GSDKKQCTVK-------------- 97
|:.|..::|.:::.....| :..||..| ||.:.. ..|.:.|.::
Rat 58 ASNDQYNFKVVDILKSQEQ-ITDSLEYYLEVNIARTMCKKIAGDNENCLIQNDPKMKKMVFCIFI 121
Fly 98 IWTQPW 103
:.::||
Rat 122 VSSKPW 127
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Cys | NP_476856.1 |
CY |
26..115 |
CDD:214484 |
13/71 (18%) |
Cst13 | NP_001102813.1 |
CY |
44..139 |
CDD:214484 |
13/71 (18%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1565344at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.