DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cys and CG8066

DIOPT Version :9

Sequence 1:NP_476856.1 Gene:Cys / 41767 FlyBaseID:FBgn0004629 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001262569.1 Gene:CG8066 / 41766 FlyBaseID:FBgn0038243 Length:104 Species:Drosophila melanogaster


Alignment Length:100 Identity:81/100 - (81%)
Similarity:90/100 - (90%) Gaps:1/100 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VVGGVSQLEGNSRKEALELLDATLAQLATGDGPSYKAINVTSVTGQVVAGSLNTYEVELDNGSDK 91
            :|||:||||||.||||||||||||||||.||||||||:||||||||||||.||||||:|||||:.
  Fly     6 IVGGISQLEGNERKEALELLDATLAQLANGDGPSYKALNVTSVTGQVVAGRLNTYEVQLDNGSEI 70

  Fly    92 KQCTVKIWTQPWLKENGTNIKIKCSGDDGELDRTW 126
            ||.||:||::.||||||||||||..|:| |||.||
  Fly    71 KQGTVQIWSRAWLKENGTNIKIKFPGED-ELDHTW 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CysNP_476856.1 CY 26..115 CDD:214484 73/87 (84%)
CG8066NP_001262569.1 CY 6..93 CDD:298856 72/86 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450199
Domainoid 1 1.000 50 1.000 Domainoid score I18827
eggNOG 1 0.900 - - E1_2CZYG
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I7659
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565344at2759
OrthoFinder 1 1.000 - - FOG0014377
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12319
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.