DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cys and Cst5

DIOPT Version :9

Sequence 1:NP_476856.1 Gene:Cys / 41767 FlyBaseID:FBgn0004629 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001102431.1 Gene:Cst5 / 366219 RGDID:1310978 Length:158 Species:Rattus norvegicus


Alignment Length:134 Identity:35/134 - (26%)
Similarity:56/134 - (41%) Gaps:29/134 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCILGLVLVSLI----ATQAADEQV-VGGVSQLEGNSRKEALELLDATLAQLATGDGPSY--KAI 64
            |..|.|.|...:    :|.|..:|| ||||...:.|. ||..::::..:......:...|  :.|
  Rat    22 LAALALTLALTVNPAASTNAKGKQVAVGGVEPADPND-KEVQKVINFAVKTYNDMNNDLYLSRPI 85

  Fly    65 NVTSVTGQVVAGSLNTYEVEL------------------DNGSDKKQ--CTVKIWTQPWL-KENG 108
            .|.|.:.|||:|.....::||                  :....:|:  |..:|..:||| |.:.
  Rat    86 RVMSASQQVVSGKNFYLKIELGQTMCTKAQSDLADCPFNEQPDQQKRAVCNFQINVEPWLNKISL 150

  Fly   109 TNIK 112
            ||.|
  Rat   151 TNFK 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CysNP_476856.1 CY 26..115 CDD:214484 29/111 (26%)
Cst5NP_001102431.1 CY 48..156 CDD:214484 27/108 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CZYG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565344at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.