DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cys and CG31313

DIOPT Version :9

Sequence 1:NP_476856.1 Gene:Cys / 41767 FlyBaseID:FBgn0004629 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001262567.1 Gene:CG31313 / 318677 FlyBaseID:FBgn0051313 Length:124 Species:Drosophila melanogaster


Alignment Length:128 Identity:58/128 - (45%)
Similarity:82/128 - (64%) Gaps:6/128 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNVVKSLCILGLVLVSLIATQAADEQVVGGVSQLEGNSRKEALELLDATLAQLATGDGPSYKAIN 65
            |..||.:.:|.:.|....|......   |....|:|:...:|.||||.|||:|||||||:|:.:|
  Fly     1 MQSVKVIFVLSVTLAVAFANPRLPP---GAPKPLDGDDLSKAKELLDTTLAKLATGDGPNYQVVN 62

  Fly    66 VTSVTGQVVAGSLNTYEVELDNGSDKKQCTVKIWTQPWLKENG--TNIKIKCSGDDGELDRTW 126
            |.|.:.|:|||||..:||:|.||::.|:|.||||.:|||.|.|  ||:|::|. |:..|::||
  Fly    63 VISASSQLVAGSLYKFEVKLSNGAETKECNVKIWDRPWLHEQGEATNVKVQCK-DEDVLEKTW 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CysNP_476856.1 CY 26..115 CDD:214484 47/90 (52%)
CG31313NP_001262567.1 CY 25..115 CDD:298856 47/92 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450200
Domainoid 1 1.000 50 1.000 Domainoid score I18827
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I7659
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565344at2759
OrthoFinder 1 1.000 - - FOG0014377
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12319
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.