DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cys and CG15369

DIOPT Version :9

Sequence 1:NP_476856.1 Gene:Cys / 41767 FlyBaseID:FBgn0004629 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001285041.1 Gene:CG15369 / 31862 FlyBaseID:FBgn0030105 Length:122 Species:Drosophila melanogaster


Alignment Length:108 Identity:41/108 - (37%)
Similarity:57/108 - (52%) Gaps:2/108 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVLVSLIATQAADEQVVGGVSQLEGNSRKEALELLDATLAQLATGDGPSYKAINVTSVTGQVVAG 76
            |:|.:.....:|....:|....|||.....|.:.|:|:|.:||.|:||.|:...:.|.|.|||:|
  Fly     7 LILCTACVLVSATPFGLGAPKVLEGEDLASAQQTLEASLTKLAAGEGPHYRLSKILSATSQVVSG 71

  Fly    77 SLNTYEVEL-DNGSDKKQCTVKIWTQPWLKENGTNIKIKCSGD 118
            ..|.|.||| ||....|.|.|.||:|.|| .||..:..:|..:
  Fly    72 FKNDYSVELIDNQGATKVCQVDIWSQSWL-PNGIQVTFRCPNE 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CysNP_476856.1 CY 26..115 CDD:214484 37/89 (42%)
CG15369NP_001285041.1 CY 24..110 CDD:238002 37/86 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450203
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I7659
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565344at2759
OrthoFinder 1 1.000 - - FOG0014377
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12319
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.