DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cys and Cst7

DIOPT Version :9

Sequence 1:NP_476856.1 Gene:Cys / 41767 FlyBaseID:FBgn0004629 Length:126 Species:Drosophila melanogaster
Sequence 2:XP_006235275.1 Gene:Cst7 / 296257 RGDID:1309154 Length:180 Species:Rattus norvegicus


Alignment Length:71 Identity:16/71 - (22%)
Similarity:25/71 - (35%) Gaps:21/71 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 TGDGPSYKAINVTSVTGQVVAGSLNTYEVELDNGSDKK---------------------QCTVKI 98
            |.|...:|..:|:....|||.|.....:||:...:.:|                     .|..::
  Rat    99 TNDIFLFKESHVSKALVQVVKGLKYMLQVEIGRTTCRKTMHRQLDNCDFQTSPALKRTLHCYSEV 163

  Fly    99 WTQPWL 104
            |..|||
  Rat   164 WVIPWL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CysNP_476856.1 CY 26..115 CDD:214484 16/71 (23%)
Cst7XP_006235275.1 CY 71..180 CDD:214484 16/71 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565344at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.