powered by:
Protein Alignment Cys and Cst7
DIOPT Version :9
Sequence 1: | NP_476856.1 |
Gene: | Cys / 41767 |
FlyBaseID: | FBgn0004629 |
Length: | 126 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_034107.2 |
Gene: | Cst7 / 13011 |
MGIID: | 1298217 |
Length: | 144 |
Species: | Mus musculus |
Alignment Length: | 71 |
Identity: | 16/71 - (22%) |
Similarity: | 25/71 - (35%) |
Gaps: | 21/71 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 TGDGPSYKAINVTSVTGQVVAGSLNTYEVELDNGSDKK---------------------QCTVKI 98
|.|...:|..:|:....|||.|.....||::...:.:| .|..::
Mouse 63 TNDIFLFKESHVSKALVQVVKGLKYMLEVKIGRTTCRKTMHHQLDNCDFQTNPALKRTLYCYSEV 127
Fly 99 WTQPWL 104
|..|||
Mouse 128 WVIPWL 133
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1565344at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.