DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8066 and CYSA

DIOPT Version :9

Sequence 1:NP_001262569.1 Gene:CG8066 / 41766 FlyBaseID:FBgn0038243 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_181620.1 Gene:CYSA / 818685 AraportID:AT2G40880 Length:125 Species:Arabidopsis thaliana


Alignment Length:81 Identity:20/81 - (24%)
Similarity:34/81 - (41%) Gaps:5/81 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVGGISQLEGNERKEALELLDATLAQLANGDGPSYKAL---NVTSVTGQVVAGRLNTYEVQLDNG 67
            ::||:..|.||:....:|.|.....|..|..  ..|.|   .:.....|||||.:....::...|
plant    34 MLGGVHDLRGNQNSGEIESLARFAIQEHNKQ--QNKILEFKKIVKAREQVVAGTMYHLTLEAKEG 96

  Fly    68 SEIKQGTVQIWSRAWL 83
            .:.|....::|.:.|:
plant    97 DQTKNFEAKVWVKPWM 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8066NP_001262569.1 CY 6..93 CDD:298856 20/81 (25%)
CYSANP_181620.1 CY 33..121 CDD:214484 20/81 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CZYG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565344at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.