powered by:
Protein Alignment CG8066 and Cstdc1
DIOPT Version :9
Sequence 1: | NP_001262569.1 |
Gene: | CG8066 / 41766 |
FlyBaseID: | FBgn0038243 |
Length: | 104 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_084411.1 |
Gene: | Cstdc1 / 78609 |
MGIID: | 1925859 |
Length: | 130 |
Species: | Mus musculus |
Alignment Length: | 58 |
Identity: | 17/58 - (29%) |
Similarity: | 26/58 - (44%) |
Gaps: | 17/58 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 VPIVGGISQLEGNE----RKEALEL---LDATLAQLA------NGDGP---SYKALNV 45
||::.|:..| |.. .||.|:: ||..:|.:. |.:.| :||.|.|
Mouse 5 VPMLVGLVVL-GTHIWTINKEFLDVTKDLDYFVASVEFAVAQFNDNNPEENTYKLLEV 61
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG8066 | NP_001262569.1 |
CY |
6..93 |
CDD:298856 |
15/56 (27%) |
Cstdc1 | NP_084411.1 |
CY |
35..128 |
CDD:298856 |
7/27 (26%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1565344at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.