powered by:
Protein Alignment CG8066 and LOC689220
DIOPT Version :9
Sequence 1: | NP_001262569.1 |
Gene: | CG8066 / 41766 |
FlyBaseID: | FBgn0038243 |
Length: | 104 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_003749635.1 |
Gene: | LOC689220 / 689220 |
RGDID: | 1594832 |
Length: | 141 |
Species: | Rattus norvegicus |
Alignment Length: | 61 |
Identity: | 20/61 - (32%) |
Similarity: | 31/61 - (50%) |
Gaps: | 3/61 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 IVGGISQLEGNERKEALELLDATLAQLANGDGPSY--KALNVTSVTGQVVAGRLNTYEVQL 64
|:|||.: ...|.:.|.|.|:..::|....:...| :.|.|.:|..|||||....::|.|
Rat 30 ILGGIEK-SSMEDEGARESLNFAVSQYNENNSDLYLSRVLEVKNVQKQVVAGTKFLFDVIL 89
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG8066 | NP_001262569.1 |
CY |
6..93 |
CDD:298856 |
20/61 (33%) |
LOC689220 | XP_003749635.1 |
CY |
30..139 |
CDD:214484 |
20/61 (33%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2CZYG |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1565344at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.