DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8066 and CG31313

DIOPT Version :9

Sequence 1:NP_001262569.1 Gene:CG8066 / 41766 FlyBaseID:FBgn0038243 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_001262567.1 Gene:CG31313 / 318677 FlyBaseID:FBgn0051313 Length:124 Species:Drosophila melanogaster


Alignment Length:99 Identity:49/99 - (49%)
Similarity:68/99 - (68%) Gaps:2/99 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GGISQLEGNERKEALELLDATLAQLANGDGPSYKALNVTSVTGQVVAGRLNTYEVQLDNGSEIKQ 72
            |....|:|::..:|.||||.|||:||.||||:|:.:||.|.:.|:|||.|..:||:|.||:|.|:
  Fly    26 GAPKPLDGDDLSKAKELLDTTLAKLATGDGPNYQVVNVISASSQLVAGSLYKFEVKLSNGAETKE 90

  Fly    73 GTVQIWSRAWLKENG--TNIKIKFPGEDELDHTW 104
            ..|:||.|.||.|.|  ||:|::...||.|:.||
  Fly    91 CNVKIWDRPWLHEQGEATNVKVQCKDEDVLEKTW 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8066NP_001262569.1 CY 6..93 CDD:298856 44/86 (51%)
CG31313NP_001262567.1 CY 25..115 CDD:298856 44/88 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450201
Domainoid 1 1.000 50 1.000 Domainoid score I18827
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I7659
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565344at2759
OrthoFinder 1 1.000 - - FOG0014377
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12319
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.