DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8066 and CG15369

DIOPT Version :9

Sequence 1:NP_001262569.1 Gene:CG8066 / 41766 FlyBaseID:FBgn0038243 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_001285041.1 Gene:CG15369 / 31862 FlyBaseID:FBgn0030105 Length:122 Species:Drosophila melanogaster


Alignment Length:95 Identity:39/95 - (41%)
Similarity:54/95 - (56%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VGGISQLEGNERKEALELLDATLAQLANGDGPSYKALNVTSVTGQVVAGRLNTYEVQL-DNGSEI 70
            :|....|||.:...|.:.|:|:|.:||.|:||.|:...:.|.|.|||:|..|.|.|:| ||....
  Fly    23 LGAPKVLEGEDLASAQQTLEASLTKLAAGEGPHYRLSKILSATSQVVSGFKNDYSVELIDNQGAT 87

  Fly    71 KQGTVQIWSRAWLKENGTNIKIKFPGEDEL 100
            |...|.|||::|| .||..:..:.|.|.||
  Fly    88 KVCQVDIWSQSWL-PNGIQVTFRCPNEPEL 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8066NP_001262569.1 CY 6..93 CDD:298856 35/86 (41%)
CG15369NP_001285041.1 CY 24..110 CDD:238002 35/86 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450204
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I7659
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565344at2759
OrthoFinder 1 1.000 - - FOG0014377
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12319
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.