powered by:
Protein Alignment CG8066 and RGD1563136
DIOPT Version :9
Sequence 1: | NP_001262569.1 |
Gene: | CG8066 / 41766 |
FlyBaseID: | FBgn0038243 |
Length: | 104 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_215875.4 |
Gene: | RGD1563136 / 296230 |
RGDID: | 1563136 |
Length: | 176 |
Species: | Rattus norvegicus |
Alignment Length: | 47 |
Identity: | 8/47 - (17%) |
Similarity: | 20/47 - (42%) |
Gaps: | 18/47 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 LNVTSVTGQVVAGRLNTYEVQLDNGSEIKQGTVQIWSRAWLKENGTN 89
||.:.||.:.:..| :::::|.::::|..|
Rat 19 LNFSDVTAKRICER------------------IEMFARNFMEKNKLN 47
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG8066 | NP_001262569.1 |
CY |
6..93 |
CDD:298856 |
8/47 (17%) |
RGD1563136 | XP_215875.4 |
CY |
<99..174 |
CDD:298856 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1565344at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.