DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8066 and CST6

DIOPT Version :9

Sequence 1:NP_001262569.1 Gene:CG8066 / 41766 FlyBaseID:FBgn0038243 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_001314.1 Gene:CST6 / 1474 HGNCID:2478 Length:149 Species:Homo sapiens


Alignment Length:94 Identity:19/94 - (20%)
Similarity:32/94 - (34%) Gaps:29/94 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SNVPIVGGIS-------QLEGNERKEALELLDATLAQLANGDGPSYKA----------------- 42
            ||:|:..|::       .|..:.|....|.:...|..|:..|....||                 
Human     4 SNLPLALGLALVAFCLLALPRDARARPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYY 68

  Fly    43 ---LNVTSVTGQVVAGRLNTYEVQLDNGS 68
               .::.....|:|||  ..|.:.::.||
Human    69 FRDTHIIKAQSQLVAG--IKYFLTMEMGS 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8066NP_001262569.1 CY 6..93 CDD:298856 16/90 (18%)
CST6NP_001314.1 CY 33..147 CDD:214484 12/65 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CZYG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565344at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.