powered by:
Protein Alignment CG8066 and LOC105945141
DIOPT Version :9
Sequence 1: | NP_001262569.1 |
Gene: | CG8066 / 41766 |
FlyBaseID: | FBgn0038243 |
Length: | 104 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004914733.1 |
Gene: | LOC105945141 / 105945141 |
-ID: | - |
Length: | 137 |
Species: | Xenopus tropicalis |
Alignment Length: | 62 |
Identity: | 17/62 - (27%) |
Similarity: | 25/62 - (40%) |
Gaps: | 8/62 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 SQLEGNER------KEALELLDATLAQLANGDGPSY--KALNVTSVTGQVVAGRLNTYEVQL 64
:||.|..| |..||.|.....:...|:...| |...:.....|||||.:...:|::
Frog 32 NQLLGGWRDAKEDDKSVLEALQFATEEYNKGNNGEYIAKVHRIIRFRKQVVAGMIYAMDVEV 93
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG8066 | NP_001262569.1 |
CY |
6..93 |
CDD:298856 |
17/62 (27%) |
LOC105945141 | XP_004914733.1 |
CY |
33..135 |
CDD:214484 |
17/61 (28%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1565344at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.