powered by:
Protein Alignment CG8066 and XB5728872
DIOPT Version :9
Sequence 1: | NP_001262569.1 |
Gene: | CG8066 / 41766 |
FlyBaseID: | FBgn0038243 |
Length: | 104 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002937491.1 |
Gene: | XB5728872 / 100498162 |
XenbaseID: | XB-GENE-5728873 |
Length: | 133 |
Species: | Xenopus tropicalis |
Alignment Length: | 60 |
Identity: | 16/60 - (26%) |
Similarity: | 26/60 - (43%) |
Gaps: | 2/60 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 NGDGPSYKALNVTSVTGQVVAGRLNTYEVQLDNGSEIKQGTVQIWSRAWLKENGTNIKIK 93
:.|...|:.:.|.|...|||||. .|.:|:..|:...:....:..::.....|.|.|.|
Frog 52 SNDAHIYRKIKVLSAKSQVVAGM--NYIIQMKIGATNCRKNSNVNLQSCQLAQGANSKTK 109
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG8066 | NP_001262569.1 |
CY |
6..93 |
CDD:298856 |
15/58 (26%) |
XB5728872 | XP_002937491.1 |
CY |
22..130 |
CDD:214484 |
16/60 (27%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1565344at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.