DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde6 and pde9ab

DIOPT Version :9

Sequence 1:NP_001262566.1 Gene:Pde6 / 41760 FlyBaseID:FBgn0038237 Length:1124 Species:Drosophila melanogaster
Sequence 2:XP_700447.5 Gene:pde9ab / 571737 ZFINID:ZDB-GENE-210629-1 Length:518 Species:Danio rerio


Alignment Length:526 Identity:136/526 - (25%)
Similarity:241/526 - (45%) Gaps:75/526 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 SADSFEEKKMRNRFTVLFELGGEYQAANVSRP----SVSEL--SSSTLAQ--IAQFVATTGQTVN 540
            |:.|:..|      |:..::.|:.|....||.    .:.:|  |||.:|:  ....:.:.|..::
Zfish     4 SSSSYTPK------TIYLDVDGKVQRVIFSRHCSPCDIRDLLCSSSNIARNTAVLLIDSEGALIS 62

  Fly   541 ICDV--------IEWVRDHNQIRAEDEIDSTQAILCMPIMNAQKKVIGVAQLINKANGVPFTDSD 597
            |...        :..|..|:..:.|::.|..|.:|..           ||:...:|..:....::
Zfish    63 IDPTMPANTPNNLYKVMSHSTNQGEEKEDMFQNVLSQ-----------VAEQFTRAFRISELKTE 116

  Fly   598 A----SIFEAFAIFCGLGIHNTQMYENACKLM------AKQKVALECLSYHATASQDQTEKLT-- 650
            .    ::.|......||.:...:..:|..|.:      ...:|...| .|:.|   |..:||:  
Zfish   117 VTNRLAMLEKRVELEGLKVVEIEKCKNDLKKLKDEMTSGSMRVNCNC-KYNFT---DDGKKLSPR 177

  Fly   651 QDVIAEAESYNLYSF-----------TFTDFELVDDDTCRAVLRMFMQCNLVSQFQIPYDVLCRW 704
            :||    .:|..|:.           ||..:....::....:..|:....||.:|.:....|.||
Zfish   178 RDV----PNYPKYTLSQETIDALKKPTFDVWHWEHNEMLSCLEYMYHDLGLVKEFNMNPITLKRW 238

  Fly   705 VLSVRKNYRPVKYHNWRHALNVAQTMFAMLK-TGKMERF-MTDLEILGLLVACLCHDLDHRGTNN 767
            :|::::|||...:||:||...|:|.|:.|:. .|..:|. |||:.|  |:.|.:||||||.|.||
Zfish   239 LLAIQENYRDNPFHNFRHCFCVSQMMYGMIHLCGLQDRLTMTDMCI--LMTAAVCHDLDHPGYNN 301

  Fly   768 AFQTKTESPLAILYT-TSTMEHHHFDQCVMILNSEGNNIFQALSPEDYRSVMKTVESAILSTDLA 831
            .:|....:.||:.|. .|.:|:||......||:....|||..:.||.::.:.:.:.:.||:||:|
Zfish   302 TYQINARTELAVRYNDISPLENHHCAVAFQILSMPECNIFANIEPESFKQIRQAIITLILATDMA 366

  Fly   832 MYFKKRNAFLELVENGEFDWQGEEKKDLLCGMMMTACDVSAIAKPWEVQHKVAKLVADEFFDQGD 896
            .:.:..::|.:.|:|  ||...||....|..:::..||:|...:|.||.......:.:|:|.|.|
Zfish   367 KHGEILDSFKQKVDN--FDCTNEEHVKSLKMVLIKCCDISNEVRPTEVAEPWVDCLLEEYFMQSD 429

  Fly   897 LEKLQLNTQPVA-MMDRERKDELPKMQVGFIDVICLPLYRVLCDTFPWITPLYEGTLENRRNWQD 960
            .||.:  ..||| .|||::..: |..|:|||..:.:|::..:...||.|..:....|.:.|:..:
Zfish   430 REKSE--GLPVAPFMDRDKVTK-PTAQIGFIKFVLIPMFETVMKLFPQIEEIMVQPLRDSRDHYE 491

  Fly   961 LAEKVE 966
            ..:::|
Zfish   492 ELKQIE 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde6NP_001262566.1 GAF 247..406 CDD:214500
GAF 431..619 CDD:214500 27/154 (18%)
PDEase_I 717..950 CDD:278654 80/236 (34%)
pde9abXP_700447.5 PDEase_I 251..481 CDD:278654 80/236 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.