DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde6 and pde3b

DIOPT Version :9

Sequence 1:NP_001262566.1 Gene:Pde6 / 41760 FlyBaseID:FBgn0038237 Length:1124 Species:Drosophila melanogaster
Sequence 2:XP_691883.4 Gene:pde3b / 563432 ZFINID:ZDB-GENE-160728-20 Length:1103 Species:Danio rerio


Alignment Length:488 Identity:121/488 - (24%)
Similarity:188/488 - (38%) Gaps:117/488 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   626 AKQKVALECLSYHATASQDQT-------EKLTQD-VIAEAESY--NLYSFTFTDFELVD---DDT 677
            |.:||..:......|:|.:|:       |:...| ::.|.|..  .:.::.|..|||:|   ..|
Zfish   613 AGEKVNSQPEEEEQTSSTEQSSLDPEGDEEFRLDLMLVEHEELMEKINTWNFQIFELMDLTGGKT 677

  Fly   678 CR----AVLRMFMQCNLVSQFQIPYDVLCRWVLSVRKNYRPVKYHNWRHALNVAQTMFAM----- 733
            .|    ....:|....|...|:||......:..::...||.:.|||..||.:|...::.:     
Zfish   678 GRILSYVAYTLFQDTGLFEIFKIPVREFMTYFCALENGYRDIPYHNRVHATDVLHAVWYLTTQPI 742

  Fly   734 ----------------------------LKTGKMERFMTD-----------LEILGLLVACLCHD 759
                                        ..|.|...|..|           ||::.|.||...||
Zfish   743 PGFQQIHNEHVTGSDTDSDSGISPGRVAYATSKSSSFQDDSYGCLAWNVPALELMALYVAAAMHD 807

  Fly   760 LDHRGTNNAFQTKTESPLAILYT-TSTMEHHHFDQC-VMILNSEGNNIFQALSPEDYRSVMKTVE 822
            .||.|..|||...|.:|.|:||. .|.:|:||.... .:.|:....|....|...:::.....|.
Zfish   808 YDHPGRTNAFLVATNAPQAVLYNDRSVLENHHAASAWSLFLSRPEFNFLCNLDHVEFKRFRFLVI 872

  Fly   823 SAILSTDLAMYF---KKRNAFLELVENGEFDWQGEEKKDLLCGMMMTACDVSAIAKPWEVQHKVA 884
            .|||:|||..:|   .:.|:.:..|.:...||..|..:.|:|.:.:...|::..||...:..|..
Zfish   873 EAILATDLKKHFDFLAEFNSKVNDVNSPGIDWTNENDRLLVCQVCIKLADINGPAKDRSLHLKWT 937

  Fly   885 KLVADEFFDQGDLE-KLQLNTQPVAMMDRERKDELPKMQVGFIDVICLPLYRVLCDTFP------ 942
            :.:.:||::|||.| .|.|...|  .|||. ..:|.|:|..||..|..|    ||:::.      
Zfish   938 EGIVNEFYEQGDEEGTLGLPISP--FMDRS-APQLAKLQESFITHIVGP----LCNSYDAAGLLP 995

  Fly   943 --WITPLYEG------TLENRRNWQDLAEKVE--------------MGLTWIDHDTIDKPVEEFA 985
              ||..  ||      |.:|....::|.|.:|              |.....:|....|.:||  
Zfish   996 GYWIDE--EGSDDEEETEDNETEDEELDEDLEPKRRKRRRRLFCNIMQHLTENHKVWKKTIEE-- 1056

  Fly   986 ACADEEIKDIEFTVTTLNCNQQSQHGSEDSHTP 1018
               :|:.|::|        .||.|...:.|..|
Zfish  1057 ---EEKAKELE--------TQQKQQQQQQSEGP 1078

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde6NP_001262566.1 GAF 247..406 CDD:214500
GAF 431..619 CDD:214500
PDEase_I 717..950 CDD:278654 77/290 (27%)
pde3bXP_691883.4 PDEase_I 721..995 CDD:278654 75/280 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.