DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde6 and Pde3a

DIOPT Version :9

Sequence 1:NP_001262566.1 Gene:Pde6 / 41760 FlyBaseID:FBgn0038237 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_061249.1 Gene:Pde3a / 54611 MGIID:1860764 Length:1141 Species:Mus musculus


Alignment Length:445 Identity:104/445 - (23%)
Similarity:169/445 - (37%) Gaps:125/445 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   662 LYSFTFTDFELVDD--DTCRAVL-----RMFMQCNLVSQFQIPYDVLCRWVLSVRKNYRPVKYHN 719
            |.::.|..|:|:::  ..|..:|     |:|....|...|:||......:..::...||.:.|||
Mouse   689 LNTWNFPIFDLMENIGRKCGRILSQVSYRLFEDMGLFEAFKIPVREFMNYFHALEIGYRDIPYHN 753

  Fly   720 WRHALNVAQTMFAML--------------------------------------------KTGKME 740
            ..||.:|...::.:.                                            |.|.:.
Mouse   754 RIHATDVLHAVWYLTTQPIPGLPSVIGDHGSASDSDSDSGFTHGHMGYVFSKMYHVPDDKYGCLS 818

  Fly   741 RFMTDLEILGLLVACLCHDLDHRGTNNAFQTKTESPLAILYT-TSTMEHHHFDQCVMILNSEGN- 803
            ..:..||::.|.||...||.||.|..|||...|.:|.|:||. .|.:|:||......:..|... 
Mouse   819 GNIPALELMALYVAAAMHDYDHPGRTNAFLVATSAPQAVLYNDRSVLENHHAAAAWNLFMSRPEY 883

  Fly   804 NIFQALSPEDYRSVMKTVESAILSTDLAMYF---KKRNAFLELVENGEFDWQGEEKKDLLCGMMM 865
            |....|...:::.....|..|||:|||..:|   .|.||  ::.::...||..|..:.|:|.|.:
Mouse   884 NFLVNLDHVEFKHFRFLVIEAILATDLKKHFDFVAKFNA--KVNDDVGIDWTNENDRLLVCQMCI 946

  Fly   866 TACDVSAIAKPWEVQHKVAKLVADEFFDQGDLE-KLQLNTQPVAMMDRERKDELPKMQVGFIDVI 929
            ...|::..||..|:..:..:.:|.||::|||.| .|.|...|  .|||. ..:|..:|..||..|
Mouse   947 KLADINGPAKCKELHLRWTEGIASEFYEQGDEEASLGLPISP--FMDRS-APQLANLQESFISHI 1008

  Fly   930 CLPLYRVLCDTF--------PWI--------------------TP-------------------- 946
            ..|    ||.::        .|:                    ||                    
Mouse  1009 VGP----LCHSYDSAGLMPGKWVDDSDDSGDTDDPEEEEEEAETPHEDEACESSIAPRKKSFKRR 1069

  Fly   947 -----LYEGTLENRRNWQDLAEKVEMGLTWIDHDTIDK-----PVEEFAACADEE 991
                 :.:..|:|...|:.:.|: |..|:..::.::|:     |.|:..|..:||
Mouse  1070 RIYCQITQHLLQNHMMWKKVIEE-EQCLSGTENQSLDQVPLQHPSEQIQAIKEEE 1123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde6NP_001262566.1 GAF 247..406 CDD:214500
GAF 431..619 CDD:214500
PDEase_I 717..950 CDD:278654 78/335 (23%)
Pde3aNP_061249.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..111
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 433..483
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 505..654
PDEase_I 751..1012 CDD:278654 73/269 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1024..1060 3/35 (9%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1120..1141 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.