DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde6 and PDE7A

DIOPT Version :9

Sequence 1:NP_001262566.1 Gene:Pde6 / 41760 FlyBaseID:FBgn0038237 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_001229247.1 Gene:PDE7A / 5150 HGNCID:8791 Length:482 Species:Homo sapiens


Alignment Length:398 Identity:107/398 - (26%)
Similarity:178/398 - (44%) Gaps:57/398 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   592 PFTDSDASIFEAFAIFCGLGIHNTQMYE------NACKLMAKQKVALECLSYHATASQDQTEKLT 650
            |:.|        |.||     |:....|      |..:|::.|:.......:..||..:....|.
Human    86 PYID--------FRIF-----HSQSEIEVSVSARNIRRLLSFQRYLRSSRFFRGTAVSNSLNILD 137

  Fly   651 QDVIAEA----ESYNLYSFTFTDFELVDDDTCRAVL--RMFMQCNLVSQFQIPYDVLCRWVLSVR 709
            .|...:|    |....::|....|:.:.:......|  .:|....|:..|.:....|.|:::.::
Human   138 DDYNGQAKCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMMKLRRFLVMIQ 202

  Fly   710 KNYRPVK-YHNWRHALNVAQTMFAMLKTGKMERFMTDLEILGLLVACLCHDLDHRGTNNAFQTKT 773
            ::|.... |||..||.:|.|.|...||..|:...:|..:||..|:|...|||||.|.|..|..||
Human   203 EDYHSQNPYHNAVHAADVTQAMHCYLKEPKLANSVTPWDILLSLIAAATHDLDHPGVNQPFLIKT 267

  Fly   774 ESPLAILY-TTSTMEHHHFDQCVMILNSEGNNIFQALSPEDYRSVMKT-VESAILSTDLAMYFKK 836
            ...||.|| .||.:|:||:...|.:|...|  :|..| |.:.|..|:| :.:.||:||::    :
Human   268 NHYLATLYKNTSVLENHHWRSAVGLLRESG--LFSHL-PLESRQQMETQIGALILATDIS----R 325

  Fly   837 RNAFLEL----VENGEFDWQGEEKKDLLCGMMMTACDVSAIAKPWEVQHKVAKLVADEFFDQGDL 897
            :|.:|.|    ::.|:...:....:.|:..|.:...|:....:.||:..:.::.|.:|||.|||:
Human   326 QNEYLSLFRSHLDRGDLCLEDTRHRHLVLQMALKCADICNPCRTWELSKQWSEKVTEEFFHQGDI 390

  Fly   898 E-KLQLNTQPVAMMDRERKDELPKMQVGFIDVICLPLYRVLCDTFPWI----TPLYEGTLE---- 953
            | |..|...|  :.|| ..:.:..:|:||:..:..||:.      .|.    |.|.:..|.    
Human   391 EKKYHLGVSP--LCDR-HTESIANIQIGFMTYLVEPLFT------EWARFSNTRLSQTMLGHVGL 446

  Fly   954 NRRNWQDL 961
            |:.:|:.|
Human   447 NKASWKGL 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde6NP_001262566.1 GAF 247..406 CDD:214500
GAF 431..619 CDD:214500 6/26 (23%)
PDEase_I 717..950 CDD:278654 78/243 (32%)
PDE7ANP_001229247.1 PDEase_I 211..444 CDD:395177 79/248 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.