DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde6 and PDE3A

DIOPT Version :9

Sequence 1:NP_001262566.1 Gene:Pde6 / 41760 FlyBaseID:FBgn0038237 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_000912.3 Gene:PDE3A / 5139 HGNCID:8778 Length:1141 Species:Homo sapiens


Alignment Length:458 Identity:107/458 - (23%)
Similarity:170/458 - (37%) Gaps:130/458 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   652 DVIAEAESYNLYSFTFTDFELVDD--DTCRAVL-----RMFMQCNLVSQFQIPYDVLCRWVLSVR 709
            |.|.|    .|.::.|..|:||::  ..|..:|     |:|....|...|:||......:..::.
Human   683 DSIME----QLNTWNFPIFDLVENIGRKCGRILSQVSYRLFEDMGLFEAFKIPIREFMNYFHALE 743

  Fly   710 KNYRPVKYHNWRHALNVAQTMFAML---------------------------------------- 734
            ..||.:.|||..||.:|...::.:.                                        
Human   744 IGYRDIPYHNRIHATDVLHAVWYLTTQPIPGLSTVINDHGSTSDSDSDSGFTHGHMGYVFSKTYN 808

  Fly   735 ----KTGKMERFMTDLEILGLLVACLCHDLDHRGTNNAFQTKTESPLAILYT-TSTMEHHHFDQC 794
                |.|.:...:..||::.|.||...||.||.|..|||...|.:|.|:||. .|.:|:||....
Human   809 VTDDKYGCLSGNIPALELMALYVAAAMHDYDHPGRTNAFLVATSAPQAVLYNDRSVLENHHAAAA 873

  Fly   795 VMILNSEGN-NIFQALSPEDYRSVMKTVESAILSTDLAMYFKKRNAFLELVENGE------FDWQ 852
            ..:..|... |....|...:::.....|..|||:|||..:|.....|     ||:      .||.
Human   874 WNLFMSRPEYNFLINLDHVEFKHFRFLVIEAILATDLKKHFDFVAKF-----NGKVNDDVGIDWT 933

  Fly   853 GEEKKDLLCGMMMTACDVSAIAKPWEVQHKVAKLVADEFFDQGDLE-KLQLNTQPVAMMDRERKD 916
            .|..:.|:|.|.:...|::..||..|:..:....:.:||::|||.| .|.|...|  .|||. ..
Human   934 NENDRLLVCQMCIKLADINGPAKCKELHLQWTDGIVNEFYEQGDEEASLGLPISP--FMDRS-AP 995

  Fly   917 ELPKMQVGFIDVICLPLYRVLCDTF--------PWI--------------------TPLYEGT-- 951
            :|..:|..||..|..|    ||:::        .|:                    .|..|.|  
Human   996 QLANLQESFISHIVGP----LCNSYDSAGLMPGKWVEDSDESGDTDDPEEEEEEAPAPNEEETCE 1056

  Fly   952 -----------------------LENRRNWQDLAEKVEMGLTWIDHDTIDKPVEEFAACADEEIK 993
                                   |:|.:.|:.:.|: |..|..|::.::|:..:..::...:.||
Human  1057 NNESPKKKTFKRRKIYCQITQHLLQNHKMWKKVIEE-EQRLAGIENQSLDQTPQSHSSEQIQAIK 1120

  Fly   994 DIE 996
            :.|
Human  1121 EEE 1123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde6NP_001262566.1 GAF 247..406 CDD:214500
GAF 431..619 CDD:214500
PDEase_I 717..950 CDD:278654 76/313 (24%)
PDE3ANP_000912.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 436..482
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 590..640
PDEase_I 751..1012 CDD:306695 72/272 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1023..1062 4/38 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1100..1141 4/24 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.