DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde6 and Pde3a

DIOPT Version :9

Sequence 1:NP_001262566.1 Gene:Pde6 / 41760 FlyBaseID:FBgn0038237 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_059033.1 Gene:Pde3a / 50678 RGDID:61942 Length:1141 Species:Rattus norvegicus


Alignment Length:511 Identity:116/511 - (22%)
Similarity:197/511 - (38%) Gaps:126/511 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   662 LYSFTFTDFELVDD--DTCRAVL-----RMFMQCNLVSQFQIPYDVLCRWVLSVRKNYRPVKYHN 719
            |.::.|..|:||::  ..|..:|     |:|....|...|:||......:..::...||.:.|||
  Rat   689 LNTWNFPIFDLVENIGRKCGRILSQVSYRLFEDMGLFEAFKIPVREFMNYFHALEIGYRDIPYHN 753

  Fly   720 WRHALNVAQTMFAML--------------------------------------------KTGKME 740
            ..||.:|...::.:.                                            |.|.:.
  Rat   754 RIHATDVLHAVWYLTTQPIPGLPSVIGDHGSASDSDSDSGFTHGHMGYVFSKAYHVPDDKYGCLS 818

  Fly   741 RFMTDLEILGLLVACLCHDLDHRGTNNAFQTKTESPLAILYT-TSTMEHHHFDQCVMILNSEGN- 803
            ..:..||::.|.||...||.||.|..|||...|.:|.|:||. .|.:|:||......:..|... 
  Rat   819 GNIPALELMALYVAAAMHDYDHPGRTNAFLVATSAPQAVLYNDRSVLENHHAAAAWNLFMSRPEY 883

  Fly   804 NIFQALSPEDYRSVMKTVESAILSTDLAMYF---KKRNAFLELVENGEFDWQGEEKKDLLCGMMM 865
            |....|...:::.....|..|||:|||..:|   .|.||  ::.::...||..|..:.|:|.|.:
  Rat   884 NFLVNLDHVEFKHFRFLVIEAILATDLKKHFDFVAKFNA--KVNDDVGIDWTNENDRLLVCQMCI 946

  Fly   866 TACDVSAIAKPWEVQHKVAKLVADEFFDQGDLE-KLQLNTQPVAMMDRERKDELPKMQVGFIDVI 929
            ...|::..||..::..:..:.:|.||::|||.| .|.|...|  .|||. ..:|..:|..||..|
  Rat   947 KLADINGPAKCKDLHLRWTEGIASEFYEQGDEEASLGLPISP--FMDRS-APQLANLQESFISHI 1008

  Fly   930 CLPLYRVLCDTFPWITPLYEGTLENRRNWQDLAEKVEMGLTWIDHDTIDKPVEEFAACADEEIKD 994
            ..|    ||.::.     ..|.:..:  |.|.::         |....|.|.||     :||   
  Rat  1009 VGP----LCHSYD-----SAGLMPGK--WVDDSD---------DSGDTDDPEEE-----EEE--- 1045

  Fly   995 IEFTVTTLNCNQQSQHGSEDSHTPEHQRSGSRLSMKKTGALGKAVRSKLSKTLYNSMDGSKPKTS 1059
                       .::.|..|   |.|:..:..:.|.|:             :.:|..:       :
  Rat  1046 -----------AETPHEEE---TCENSEAPRKKSFKR-------------RRIYCQI-------T 1076

  Fly  1060 LKLLESHV--SEDMDDKSPTSPSQPQASGSMGRMSASSSTSSAGGQMVDKSKKRSK 1113
            ..||::|:  .:.::::...|.::.||........:|....:...:..:|.|.|::
  Rat  1077 QHLLQNHMMWKKVIEEEQCLSGTENQAPDQAPLQHSSEQIQAIKEEEEEKGKPRAE 1132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde6NP_001262566.1 GAF 247..406 CDD:214500
GAF 431..619 CDD:214500
PDEase_I 717..950 CDD:278654 74/282 (26%)
Pde3aNP_059033.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..111
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..309
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 433..479
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 504..643
PDEase_I 751..1012 CDD:278654 72/269 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1024..1062 13/70 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1098..1141 6/35 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.