DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde6 and Pde7b

DIOPT Version :9

Sequence 1:NP_001262566.1 Gene:Pde6 / 41760 FlyBaseID:FBgn0038237 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_001334295.1 Gene:Pde7b / 29863 MGIID:1352752 Length:498 Species:Mus musculus


Alignment Length:489 Identity:122/489 - (24%)
Similarity:217/489 - (44%) Gaps:61/489 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   502 ELGGEYQAANVSRPSVSELSSSTLAQIAQFVATTGQTVNICDVIEWVRDHNQIRAEDEIDSTQAI 566
            |||..:.|.....|  |.|||....|.........:.:.:..:: |       :::.|:.:|:..
Mouse    12 ELGRRWTAPEAVLP--SSLSSRPGCQQGPLPWDLPEMIRMVKLV-W-------KSKSELQATKPR 66

  Fly   567 LCMPIMNAQKKVIGVAQLINKANGVPFTDSDASIFEAFAIFCGLGIHNTQMYENACKLMAKQKVA 631
            ..:...:|.....|..:|..: .|||.....:..|..|.:     ::||   .::.::..|:||.
Mouse    67 GILENEDASHSFPGDVRLRGQ-TGVPAERRGSYPFIDFRL-----LNNT---THSGEIGTKKKVK 122

  Fly   632 LECLS----YHAT------ASQDQTEKLTQDVIAEA----ESYNLYSFTFTDFELVDDDTCRAVL 682
             ..||    :||:      ..|.....|.:|.:.:|    .....:.|....|:.:.:......|
Mouse   123 -RLLSFQRYFHASRLLRGIIPQAPLHLLDEDYLGQARHMLSKVGTWDFDIFLFDRLTNGNSLVTL 186

  Fly   683 --RMFMQCNLVSQFQIPYDVLCRWVLSVRKNY---RPVKYHNWRHALNVAQTMFAMLKTGKMERF 742
              .:|....|:..|::....|.|:::.|:::|   .|  |||..||.:|.|.|...||..|:..|
Mouse   187 LCHLFNSHGLIHHFKLDMVTLHRFLVMVQEDYHGHNP--YHNAVHAADVTQAMHCYLKEPKLASF 249

  Fly   743 MTDLEILGLLVACLCHDLDHRGTNNAFQTKTESPLAILY-TTSTMEHHHFDQCVMILNSEGNNIF 806
            :|.|:|:..|:|...||:||.|.|..|..||...||.|| ..|.:|:||:...:.:|..  :.:.
Mouse   250 LTPLDIMLGLLAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMSVLENHHWRSTIGMLRE--SRLL 312

  Fly   807 QALSPEDYRSVMKTVESAILSTDLAMYFKKRNAFLELVE----NGEFDWQGEEKKDLLCGMMMTA 867
            ..|..|..:.:.:.:.|.||:||:    .::|.||..::    |.:...:..:.:..:..:.:..
Mouse   313 AHLPKEMTQDIEQQLGSLILATDI----NRQNEFLTRLKAHLHNKDLRLENVQDRHFMLQIALKC 373

  Fly   868 CDVSAIAKPWEVQHKVAKLVADEFFDQGDLE-KLQLNTQPVAMMDRERKDELPKMQVGFIDVICL 931
            .|:....:.||:..:.::.|.:||:.||||| |.:|...|:.   .::||.:|.:|:||:..|..
Mouse   374 ADICNPCRIWEMSKQWSERVCEEFYRQGDLEQKFELEISPLC---NQQKDSIPSIQIGFMTYIVE 435

  Fly   932 PLYRVLCDTFPWITPLYEGTL----ENRRNWQDL 961
            ||:|... .|...:.|.|..|    .|:..|:.|
Mouse   436 PLFREWA-RFTGNSTLSENMLSHLAHNKAQWKSL 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde6NP_001262566.1 GAF 247..406 CDD:214500
GAF 431..619 CDD:214500 23/116 (20%)
PDEase_I 717..950 CDD:278654 72/238 (30%)
Pde7bNP_001334295.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.