DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde6 and Pde1b

DIOPT Version :9

Sequence 1:NP_001262566.1 Gene:Pde6 / 41760 FlyBaseID:FBgn0038237 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_073201.1 Gene:Pde1b / 29691 RGDID:3278 Length:535 Species:Rattus norvegicus


Alignment Length:408 Identity:110/408 - (26%)
Similarity:184/408 - (45%) Gaps:85/408 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   661 NLYSFTFTDFEL---VDDDTCRA-VLRMFMQCNLVSQFQIPYDVLCRWVLSVRKNYRPVK--YHN 719
            ||..:.|..|.|   .||...|. |..:..:.:|:|:|:||...|..::.::...|...|  |||
  Rat   159 NLDVWCFDVFSLNRAADDHALRTIVFELLTRHSLISRFKIPTVFLMSFLEALETGYGKYKNPYHN 223

  Fly   720 WRHALNVAQTMFA-MLKTGKMERFMTDLEILGLLVACLCHDLDHRGTNNAFQTKTESPLAILYT- 782
            ..||.:|.||:.. :|:|| |...::::|:|.::.|...||.:|.||.|:|..:|:|..||||. 
  Rat   224 QIHAADVTQTVHCFLLRTG-MVHCLSEIEVLAIIFAAAIHDYEHTGTTNSFHIQTKSECAILYND 287

  Fly   783 TSTMEHHHFDQCVMILNSEGNNIFQALSPEDYRSVMKTVESAILSTDLAMYF---KKRNAFLELV 844
            .|.:|:||......::..:..|||..|:.:::..:...|...:|:||::.:|   |.....|:.:
  Rat   288 RSVLENHHISSVFRMMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTALQQL 352

  Fly   845 ENGEFDWQGEEKKDLLCGMMMTACDVSAIAKPWEVQHKVAKLVADEFFDQGDLE-KLQLNTQPVA 908
            |..:        |.....:::.|.|:|...|.|.|..:..|.:.:|||.|||.| :|.|...|:.
  Rat   353 ERID--------KSKALSLLLHAADISHPTKQWSVHSRWTKALMEEFFRQGDKEAELGLPFSPLC 409

  Fly   909 MMDRERKDEL-PKMQVGFIDVICLPLYRVLCD--------------------TFPWITPLYEGTL 952
                :|...| .:.|:||||.|..|.:.||.|                    :|.|..|..:..:
  Rat   410 ----DRTSTLVAQSQIGFIDFIVEPTFSVLTDVAEKSVQPLTDDDSKSKSQPSFQWRQPSLDVDV 470

  Fly   953 -------------------ENRRNWQDLAEKVEMGLTWIDHDTIDK--PVEEFAACADEEIKDIE 996
                               ||::.|:   |:...|:|  :..:||:  |.||.|..:..|     
  Rat   471 GDPNPDVVSFRSTWTKYIQENKQKWK---ERAASGIT--NQMSIDELSPCEEEAPSSPAE----- 525

  Fly   997 FTVTTLNCNQQSQHGSED 1014
                    ::.:|:|:.|
  Rat   526 --------DEHNQNGNLD 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde6NP_001262566.1 GAF 247..406 CDD:214500
GAF 431..619 CDD:214500
PDEase_I 717..950 CDD:278654 77/259 (30%)
Pde1bNP_073201.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Calmodulin-binding. /evidence=ECO:0000255 27..47
PDEase_I_N 80..136 CDD:400687
PDEase_I 221..448 CDD:395177 74/239 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 445..474 3/28 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 495..535 13/57 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.