DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde6 and Pde4c

DIOPT Version :9

Sequence 1:NP_001262566.1 Gene:Pde6 / 41760 FlyBaseID:FBgn0038237 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_001263694.1 Gene:Pde4c / 290646 RGDID:727918 Length:671 Species:Rattus norvegicus


Alignment Length:336 Identity:108/336 - (32%)
Similarity:161/336 - (47%) Gaps:38/336 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   644 DQTEKLTQDVIAEAESYNLYSF-TFTDFELVDDDTCRAVL-RMFMQCNLVSQFQIPYDVLCRWVL 706
            ||.|:|.:    |.|..|.:.| .|...||..:....||: .:..:.:|:..||||.|.|.|::|
  Rat   316 DQEEQLAK----ELEDTNKWGFDVFKVAELSGNRPLTAVIFSVLQERDLLKTFQIPADTLLRYLL 376

  Fly   707 SVRKNYRP-VKYHNWRHALNVAQTMFAMLKTGKMERFMTDLEILGLLVACLCHDLDHRGTNNAFQ 770
            ::..:|.. |.|||..||.:|.|:...:|.|..:|...||||:|..:.||..||:||.|.:|.|.
  Rat   377 TLEGHYHSNVAYHNSIHAADVVQSAHVLLGTPALEAVFTDLEVLAAIFACAIHDVDHPGVSNQFL 441

  Fly   771 TKTESPLAILYT-TSTMEHHHFDQCVMILNSEGNNIFQALSPEDYRSVMKTVESAILSTDLAMYF 834
            ..|.|.||::|. :|.:|:||......:|..|..:|||.||.:...|:.:.|...:|:||::.:.
  Rat   442 INTNSELALMYNDSSVLENHHLAVGFKLLQGENCDIFQNLSTKQKLSLRRMVIDMVLATDMSKHM 506

  Fly   835 KKRNAFLELVENGEFDWQGEEKKDLLCGMMMT---------------ACDVSAIAKPWEVQHKVA 884
            ........:||.         ||....|:::.               ..|:|..|||..:..:..
  Rat   507 SLLADLKTMVET---------KKVTSLGVLLLDNYSDRIQVLQSLVHCADLSNPAKPLPLYRQWT 562

  Fly   885 KLVADEFFDQGDLEKLQ-LNTQPVAMMDRERKDELPKMQVGFIDVICLPLYRVLCD-TFPWITPL 947
            :.:..|||.|||.|:.. |:..|  |.|:... .:.|.||||||.|..||:....| ..|....|
  Rat   563 ERIMAEFFQQGDRERESGLDISP--MCDKHTA-SVEKSQVGFIDYIAHPLWETWADLVHPDAQEL 624

  Fly   948 YEGTLENRRNW 958
            .: |||:.|.|
  Rat   625 LD-TLEDNREW 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde6NP_001262566.1 GAF 247..406 CDD:214500
GAF 431..619 CDD:214500
PDEase_I 717..950 CDD:278654 79/250 (32%)
Pde4cNP_001263694.1 PDEase_I 388..629 CDD:278654 80/253 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.