DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde6 and Pde9a

DIOPT Version :9

Sequence 1:NP_001262566.1 Gene:Pde6 / 41760 FlyBaseID:FBgn0038237 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_612552.1 Gene:Pde9a / 191569 RGDID:621035 Length:534 Species:Rattus norvegicus


Alignment Length:385 Identity:115/385 - (29%)
Similarity:188/385 - (48%) Gaps:59/385 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   625 MAKQKVALECLS-YHATASQDQTEKLTQDVIAEAESYNL---YSF-------------TFTDFEL 672
            |.:::|.||.|. ......:...:|:.:::.|.....|.   |||             |:..: |
  Rat   123 MLEKRVELEGLKVVEIEKCKSDIKKMREELAARNNRTNCPCKYSFLDNKKLTPRRDVPTYPKY-L 186

  Fly   673 VDDDTCRAVLR-------------------MFMQCNLVSQFQIPYDVLCRWVLSVRKNYRPVKYH 718
            :..:|..|:.:                   |:....||..|.|....|.||:|.|..|||...:|
  Rat   187 LSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPITLRRWLLCVHDNYRSNPFH 251

  Fly   719 NWRHALNVAQTMFAML-KTGKMERFMTDLEILGLLVACLCHDLDHRGTNNAFQTKTESPLAILYT 782
            |:||...|.|.|::|: ..|..|:| :.::||.|:.|.:||||||.|.||.:|....:.||:.|.
  Rat   252 NFRHCFCVTQMMYSMVWLCGLQEKF-SQMDILVLMTAAICHDLDHPGYNNTYQINARTELAVRYN 315

  Fly   783 -TSTMEHHHFDQCVMILNSEGNNIFQALSPEDYRSVMKTVESAILSTDLAMYFKKRNAFLELVEN 846
             .|.:|:||......||.....|||.::.||.:|.:.:.:.:.||:||:|.:.:..::|.|.:||
  Rat   316 DISPLENHHCAIAFQILARPECNIFASVPPEGFRQIRQGMITLILATDMARHAEIMDSFKEKMEN 380

  Fly   847 GEFDWQGEEKKDLLCGMMMTACDVSAIAKPWEVQHKVAKLVADEFFDQGDLEKLQLNTQPVA-MM 910
              ||:..||...||..:::..||:|...:|.||.......:.:|:|.|.|.||.:  ..||| .|
  Rat   381 --FDYSNEEHLTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSE--GLPVAPFM 441

  Fly   911 DRERKDELPK--MQVGFIDVICLPLYRVLCDTFP-----WITPLYEGTLENRRNWQDLAE 963
            ||   |::.|  .|:|||..:.:|::..:...||     .:.||:    |:|.::::|.:
  Rat   442 DR---DKVTKATAQIGFIKFVLIPMFETVTKLFPIVEETMLRPLW----ESREHYEELKQ 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde6NP_001262566.1 GAF 247..406 CDD:214500
GAF 431..619 CDD:214500
PDEase_I 717..950 CDD:278654 84/242 (35%)
Pde9aNP_612552.1 PDEase_I 250..478 CDD:278654 82/235 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 500..534
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.