DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde6 and Pde9a

DIOPT Version :9

Sequence 1:NP_001262566.1 Gene:Pde6 / 41760 FlyBaseID:FBgn0038237 Length:1124 Species:Drosophila melanogaster
Sequence 2:XP_036016291.1 Gene:Pde9a / 18585 MGIID:1277179 Length:536 Species:Mus musculus


Alignment Length:413 Identity:121/413 - (29%)
Similarity:199/413 - (48%) Gaps:70/413 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   627 KQKVALECLS-YHATASQDQTEKLTQDVIAEAESYNL---YSF-------------TFTDFELVD 674
            :::|.||.|. ......:...:|:.:::.|.....|.   |||             |:..: |:.
Mouse   125 EKRVELEGLKVVEIEKCKSDIKKMREELAARNSRTNCPCKYSFLDNKKLTPRRDVPTYPKY-LLS 188

  Fly   675 DDTCRAVLR-------------------MFMQCNLVSQFQIPYDVLCRWVLSVRKNYRPVKYHNW 720
            .:|..|:.:                   |:....||..|.|....|.||:|.|..|||...:||:
Mouse   189 PETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPITLRRWLLCVHDNYRNNPFHNF 253

  Fly   721 RHALNVAQTMFAML-KTGKMERFMTDLEILGLLVACLCHDLDHRGTNNAFQTKTESPLAILYT-T 783
            ||...|.|.|::|: ..|..|:| :.::||.|:.|.:||||||.|.||.:|....:.||:.|. .
Mouse   254 RHCFCVTQMMYSMVWLCGLQEKF-SQMDILVLMTAAICHDLDHPGYNNTYQINARTELAVRYNDI 317

  Fly   784 STMEHHHFDQCVMILNSEGNNIFQALSPEDYRSVMKTVESAILSTDLAMYFKKRNAFLELVENGE 848
            |.:|:||......||.....|||.::.||.:|.:.:.:.:.||:||:|.:.:..::|.|.:||  
Mouse   318 SPLENHHCAIAFQILARPECNIFASVPPEGFRQIRQGMITLILATDMARHAEIMDSFKEKMEN-- 380

  Fly   849 FDWQGEEKKDLLCGMMMTACDVSAIAKPWEVQHKVAKLVADEFFDQGDLEKLQLNTQPVA-MMDR 912
            ||:..||...||..:::..||:|...:|.||.......:.:|:|.|.|.||.:  ..||| .|||
Mouse   381 FDYSNEEHLTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSE--GLPVAPFMDR 443

  Fly   913 ERKDELPK--MQVGFIDVICLPLYRVLCDTFP-----WITPLYEGTLENRRNWQDLAEKVEMGLT 970
               |::.|  .|:|||..:.:|::..:...||     .:.||:    |:|.::::|.:       
Mouse   444 ---DKVTKATAQIGFIKFVLIPMFETVTKLFPVVEETMLRPLW----ESREHYEELKQ------- 494

  Fly   971 WIDHDTID--KPVEEFAACADEE 991
             :| |.:.  |.|:...|.|:|:
Mouse   495 -LD-DAMKEVKAVQRVQAVAEED 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde6NP_001262566.1 GAF 247..406 CDD:214500
GAF 431..619 CDD:214500
PDEase_I 717..950 CDD:278654 84/242 (35%)
Pde9aXP_036016291.1 PDEase_I 250..478 CDD:395177 82/235 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.