DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde6 and Pde7a

DIOPT Version :9

Sequence 1:NP_001262566.1 Gene:Pde6 / 41760 FlyBaseID:FBgn0038237 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_001116231.1 Gene:Pde7a / 18583 MGIID:1202402 Length:482 Species:Mus musculus


Alignment Length:316 Identity:88/316 - (27%)
Similarity:147/316 - (46%) Gaps:45/316 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   661 NLYSFTFTDFELVDDDTCRAVLRMFMQCNLVSQFQIPYDVLCRWVLSVRKNYRPVK-YHNWRHAL 724
            :|.|.||               .:|....|:..|.:....|.|:::.::::|.... |||..||.
Mouse   169 SLVSLTF---------------HLFSLHGLIEYFHLDMVKLRRFLVMIQEDYHSQNPYHNAVHAA 218

  Fly   725 NVAQTMFAMLKTGKMERFMTDLEILGLLVACLCHDLDHRGTNNAFQTKTESPLAILY-TTSTMEH 788
            :|.|.|...||..|:...:|..:||..|:|...|||||.|.|..|..||...||.|| .:|.:|:
Mouse   219 DVTQAMHCYLKEPKLASSVTPWDILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNSSVLEN 283

  Fly   789 HHFDQCVMILNSEGNNIFQALSPEDYRSVMKTVESAILSTDLAMYFKKRNAFLEL----VENGEF 849
            ||:...|.:|...|  :|..|..|..:.:...:.:.||:||::    ::|.:|.|    ::.|:.
Mouse   284 HHWRSAVGLLRESG--LFSHLPLESRQEMEAQIGALILATDIS----RQNEYLSLFRSHLDKGDL 342

  Fly   850 DWQGEEKKDLLCGMMMTACDVSAIAKPWEVQHKVAKLVADEFFDQGDLE-KLQLNTQPVAMMDRE 913
            .......:.|:..|.:...|:....:.||:..:.::.|.:|||.|||:| |..|...|  :.||:
Mouse   343 HLDDGRHRHLVLQMALKCADICNPCRNWELSKQWSEKVTEEFFHQGDIEKKYHLGVSP--LCDRQ 405

  Fly   914 RKDELPKMQVGFIDVICLPLYRVLCDTFPWI----TPLYEGTLE----NRRNWQDL 961
             .:.:..:|:||:..:..||:.      .|.    |.|.:..|.    |:.:|:.|
Mouse   406 -TESIANIQIGFMTYLVEPLFT------EWARFSDTRLSQTMLGHVGLNKASWKGL 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde6NP_001262566.1 GAF 247..406 CDD:214500
GAF 431..619 CDD:214500
PDEase_I 717..950 CDD:278654 74/242 (31%)
Pde7aNP_001116231.1 Endonuc-BglII <51..128 CDD:286304
PDEase_I 211..431 CDD:278654 72/234 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.