DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde6 and Pde1a

DIOPT Version :9

Sequence 1:NP_001262566.1 Gene:Pde6 / 41760 FlyBaseID:FBgn0038237 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_001153054.1 Gene:Pde1a / 18573 MGIID:1201792 Length:545 Species:Mus musculus


Alignment Length:348 Identity:105/348 - (30%)
Similarity:176/348 - (50%) Gaps:39/348 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   611 GIHNTQMYENACKLMAKQKVALECLSYHAT--ASQDQTEKLTQDVIAEAESYNLYSFTFTDFELV 673
            ||...:||.....::.        |:|.|.  .:..:.:|.:.||.|..|:...:|..|..:|| 
Mouse   128 GIFVERMYRKNYHMVG--------LTYPAAVIVTLKEVDKWSFDVFALNEASGEHSLKFMIYEL- 183

  Fly   674 DDDTCRAVLRMFMQCNLVSQFQIPYDVLCRWVLSVRKNYRPVK--YHNWRHALNVAQTM-FAMLK 735
                       |.:.:|:::|:||...|..:..::...|...|  |||..||.:|.||: :.||.
Mouse   184 -----------FTRYDLINRFKIPVSCLIAFAEALEVGYSKHKNPYHNLVHAADVTQTVHYIMLH 237

  Fly   736 TGKMERFMTDLEILGLLVACLCHDLDHRGTNNAFQTKTESPLAILYT-TSTMEHHHFDQCVMILN 799
            ||.| .::|:||||.::.|...||.:|.||.|.|..:|.|.:||||. .|.:|:||......::.
Mouse   238 TGIM-HWLTELEILAMVFAAAIHDYEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRLMQ 301

  Fly   800 SEGNNIFQALSPEDYRSVMKTVESAILSTDLAMYFKKRNAFLELVENGEFDWQGEEKKDLLCGMM 864
            .|..||...||.:|:|.:...|...:|:||::.:|::    ::.:.|.....:|.::...: .::
Mouse   302 EEEMNILVNLSKDDWRDLRNLVIEMVLATDMSGHFQQ----IKNIRNSLQQPEGIDRAKTM-SLI 361

  Fly   865 MTACDVSAIAKPWEVQHKVAKLVADEFFDQGDLE-KLQLNTQPVAMMDRERKDEL-PKMQVGFID 927
            :.|.|:|..||.|::.::....:.:|||.|||.| :|.|...|:.    :||..: .:.|:||||
Mouse   362 LHAADISHPAKTWKLHYRWTMALMEEFFLQGDKEAELGLPFSPLC----DRKSTMVAQSQIGFID 422

  Fly   928 VICLPLYRVLCD-TFPWITPLYE 949
            .|..|.:.:|.| |...:.||.|
Mouse   423 FIVEPTFSLLTDSTEKIVIPLIE 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde6NP_001262566.1 GAF 247..406 CDD:214500
GAF 431..619 CDD:214500 3/7 (43%)
PDEase_I 717..950 CDD:278654 81/238 (34%)
Pde1aNP_001153054.1 Calmodulin-binding 24..44
PDEase_I_N 77..133 CDD:369905 2/4 (50%)
PDEase_I 218..434 CDD:365964 76/225 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 526..545
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.