DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde6 and Pde6c

DIOPT Version :10

Sequence 1:NP_001262566.1 Gene:Pde6 / 41760 FlyBaseID:FBgn0038237 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_291092.1 Gene:Pde6c / 110855 MGIID:105956 Length:861 Species:Mus musculus


Alignment Length:58 Identity:18/58 - (31%)
Similarity:27/58 - (46%) Gaps:2/58 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   473 VPFDSYEIVDKSENTKKSSSSYHASSSYHKQAPPLPLVDYHVYD-TPTVEHFSHSPAF 529
            :|||..: ||||.:.:|..|||.|......:...|..:..|:.. |...|..::.|.|
Mouse    79 MPFDPKK-VDKSSSVEKQLSSYKAPCRGCSKKVTLVKMRSHISSCTKVQEQMANCPKF 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde6NP_001262566.1 GAF 247..406 CDD:214500
GAF 431..619 CDD:214500 18/58 (31%)
PDEase_I 717..950 CDD:459723
Pde6cNP_291092.1 GAF 81..232 CDD:214500 17/56 (30%)
GAF 256..443 CDD:214500
PDEase_I 561..805 CDD:459723
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 826..861
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.