DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde6 and pde4a

DIOPT Version :9

Sequence 1:NP_001262566.1 Gene:Pde6 / 41760 FlyBaseID:FBgn0038237 Length:1124 Species:Drosophila melanogaster
Sequence 2:XP_031755243.1 Gene:pde4a / 100488846 XenbaseID:XB-GENE-5789473 Length:744 Species:Xenopus tropicalis


Alignment Length:629 Identity:148/629 - (23%)
Similarity:253/629 - (40%) Gaps:141/629 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   465 SHLEKIIEKPNQPATRAIKSADSFEEKKMRNRFTVLFELGGEYQAANVSRPS------------- 516
            :|.|.:|..|......:::|        :||.||:|         |||:.|:             
 Frog   159 AHAEDLIVTPFAQVLASLRS--------VRNNFTIL---------ANVTTPTNKRSPVMPQQTVC 206

  Fly   517 VSELSSSTLAQIAQFVATTGQTVNICDVIEWVRDHNQIRAEDEIDSTQAILCMPIMNAQK----- 576
            .:.||..|..|:|:      :|:   :.::|        ..|::::.|....:..|.:.|     
 Frog   207 KATLSEETYQQLAK------ETL---EELDW--------CLDQLETMQTYRSVSEMASNKFKRML 254

  Fly   577 --KVIGVAQLINKANGV------PFTDSDASIFEAFAIFCGLGIHNTQMYEN--------ACKLM 625
              ::..::::....|.|      .|.|....:          .|.:....|.        .|::.
 Frog   255 NRELTHLSEMSRSGNQVSEYISNTFLDKQNEV----------DIPSPTQKEREKKKKQQPMCQIS 309

  Fly   626 AKQKVALECLSYHATA-----------SQDQTEKLTQDVIAEAESYNLYSFTFTDFELVDDDTCR 679
            ..:|:      .|:::           ..||.|.|.:: :.....:.|..|...::......:| 
 Frog   310 GVKKL------MHSSSLTNSAIPRFGVKTDQEESLGKE-LDNLNKWGLNIFRVAEYSNNRPLSC- 366

  Fly   680 AVLRMFMQCNLVSQFQIPYDVLCRWVLSVRKNYR-PVKYHNWRHALNVAQTMFAMLKTGKMERFM 743
            .:..:|.:..|:..|:||.|.|..:::::..:|. .|.|||..||.:|.|:...:|.|..::...
 Frog   367 TMYTVFQERELLKTFKIPVDTLMTYMMTLEDHYHADVAYHNSLHAADVTQSTHVLLSTPALDAVF 431

  Fly   744 TDLEILGLLVACLCHDLDHRGTNNAFQTKTESPLAILYT-TSTMEHHHFDQCVMILNSEGNNIFQ 807
            ||||||..|.|...||:||.|.:|.|...|.|.||::|. .|.:|:||......:|..|..:|||
 Frog   432 TDLEILAALFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEENCDIFQ 496

  Fly   808 ALSPEDYRSVMKTVESAILSTDLAMYFKKRNAFLELVENGEFDWQG-------EEKKDLLCGMMM 865
            .|:....:::.|.|...:|:||::.:.........:||..:....|       .::..:|..|:.
 Frog   497 NLTKRQRQTMRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTSSGVLLLDNYTDRIQVLRNMVH 561

  Fly   866 TACDVSAIAKPWEVQHKVAKLVADEFFDQGDLEKLQ-LNTQPVAMMDRERKDELPKMQVGFIDVI 929
            .| |:|...||.|:..:....:.:|||.|||.|:.: :...|  |.|:... .:.|.||||||.|
 Frog   562 CA-DLSNPTKPLELYRQWTDRILEEFFRQGDKERERGMEISP--MCDKHTA-SVEKSQVGFIDYI 622

  Fly   930 CLPLYRVLCD-TFPWITPLYEGTLENRRNW--------------------QDLAEKVEMGLTW-- 971
            ..||:....| ..|....:.: |||:.|:|                    :...||.:..||.  
 Frog   623 VHPLWETWADLVHPDAQDILD-TLEDNRDWYQGMIPQSPSPPPDDPDKDEEACIEKFQFELTLEE 686

  Fly   972 ----IDHDTIDKPVEEFAACADE--EIKDIEFTVTTLNCNQQSQ 1009
                .|.|......||...|..|  ||::.|....|::..|..|
 Frog   687 EAEDSDKDRNSGIEEEDGNCLHEAPEIQEPEEEFMTMHEGQAEQ 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde6NP_001262566.1 GAF 247..406 CDD:214500
GAF 431..619 CDD:214500 30/179 (17%)
PDEase_I 717..950 CDD:278654 77/242 (32%)
pde4aXP_031755243.1 PDE4_UCR 166..281 CDD:407935 25/148 (17%)
PDEase_I 405..646 CDD:395177 78/245 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.