DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde6 and pde3b

DIOPT Version :9

Sequence 1:NP_001262566.1 Gene:Pde6 / 41760 FlyBaseID:FBgn0038237 Length:1124 Species:Drosophila melanogaster
Sequence 2:XP_031756238.1 Gene:pde3b / 100487373 XenbaseID:XB-GENE-486086 Length:1015 Species:Xenopus tropicalis


Alignment Length:487 Identity:114/487 - (23%)
Similarity:190/487 - (39%) Gaps:115/487 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   651 QDVIAEAESYNLYSFTFTDFELVDDD-------TCRAVLRMFMQCNLVSQFQIPYDVLCRWVLSV 708
            ||.:.:    .|.::.|..|:||:..       ..:....:|....|...|:||......:..::
 Frog   567 QDSLLD----RLDNWNFPIFDLVERTGGKSGRILSQVSYTLFQDTGLFEIFKIPLREFQNFFRAL 627

  Fly   709 RKNYRPVKYHNWRHALNVAQTMFAM---------------------LKTGKMERFMTD------- 745
            ...||.:.|||..||.:|..:::.:                     .:.|..:.|:|.       
 Frog   628 ESGYRDIPYHNRIHATDVLHSVWYLSTRPIPGFHEIHSDETDPDPDAEGGASQVFLTSKTCKLPD 692

  Fly   746 ------------LEILGLLVACLCHDLDHRGTNNAFQTKTESPLAILYT-TSTMEHHHFDQC-VM 796
                        ||::.|.||...||.||.|..|||...|.:|.|:||. .|.:|:||.... .:
 Frog   693 ESYGCLSSNIPALELMALFVAAAMHDYDHPGRTNAFLVATNAPQAVLYNDRSVLENHHAASAWNL 757

  Fly   797 ILNSEGNNIFQALSPEDYRSVMKTVESAILSTDLAMYF---KKRNAFLELVENGEFDWQGEEKKD 858
            .|:...:|....|....::.....|..|||:|||..:|   .:.||.:..|.....||..|..:.
 Frog   758 FLSQPEHNFLTYLDHVQFKRFRFLVIEAILATDLKKHFDFLAEFNAKVNDVNGIGIDWSNENDRL 822

  Fly   859 LLCGMMMTACDVSAIAKPWEVQHKVAKLVADEFFDQGDLE-KLQLNTQPVAMMDRERKDELPKMQ 922
            |:|.:.:...|::..||..|:..|..:.:.:||::|||.| .|.|...|  .|||. ..:|.|:|
 Frog   823 LVCQVCIKLADINGPAKTRELHLKWTEGIVNEFYEQGDEESSLGLPISP--FMDRS-APQLAKLQ 884

  Fly   923 VGFIDVICLPLYRVLCDTFPWITPLYEGTLENRRNWQDLAEKVEMGLTWIDHDTIDKPVEEFAAC 987
            ..||..|..|    ||:::.     ..|.|..|               |::.|      ||....
 Frog   885 ESFITHIVGP----LCNSYD-----AAGLLPGR---------------WLEED------EEVMES 919

  Fly   988 ADEEIKDIEFTVTTLNCNQQSQHGSEDSHTPEHQRSGSRL-------------SMKKTGALGKAV 1039
            .||:.::::         .:.:...||.:....:|...|:             :.|||  :.:..
 Frog   920 EDEDGEELD---------SEEEEMEEDINPKPQRRKRRRMFCRLIHHLRENHKAWKKT--IEEEE 973

  Fly  1040 RSKLSKTLYNSMDG-SKPKTSLKLLESHVSED 1070
            :||..:|...|.|. :.|...::::|....|:
 Frog   974 KSKAEQTKQQSDDAPAAPPDDIQVIEEADEEE 1005

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde6NP_001262566.1 GAF 247..406 CDD:214500
GAF 431..619 CDD:214500
PDEase_I 717..950 CDD:278654 76/278 (27%)
pde3bXP_031756238.1 PDEase_I 636..906 CDD:395177 77/281 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.